Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-25/IL-17E, Human (HEK293, His)

IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (HEK293, His) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-25/IL-17E Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-25-il-17e-protein-human-hek293-his.html

Purity

98.0

Smiles

YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG

Molecular Formula

64806 (Gene_ID) Q9H293-1 (Y33-G177) (Accession)

Molecular Weight

Approximately 20-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRND antibody
70R-8065 50 ug

CHRND antibody

Sign In for Pricing
View Details
Human Tumor protein D52 (TPD52) ELISA Kit
abx250756 96 Tests

Human Tumor protein D52 (TPD52) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans pept-1 Polyclonal Antibody
MBS7191613 Inquire

Rabbit anti-Caenorhabditis elegans pept-1 Polyclonal Antibody

Sign In for Pricing
View Details
Human AP2A1 Knockout HEK293T cell line
GTR15407075 1 Vial

Human AP2A1 Knockout HEK293T cell line

Sign In for Pricing
View Details
PRAM1 (PML-RARA Target Gene Encoding Protein) (HRP) discontinued
P5600-08-HRP 100 µL

PRAM1 (PML-RARA Target Gene Encoding Protein) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Pax8 (NM_011040) AAV Particle
MR207296A1V 250 µL

Mouse Pax8 (NM_011040) AAV Particle

Sign In for Pricing
View Details