Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STUB1, Human

STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90) . STUB1 Protein, Human is the recombinant human-derived STUB1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

STUB1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stub1-protein-human.html

Purity

98.0

Smiles

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Molecular Formula

10273 (Gene_ID) Q9UNE7 (M1-Y303) (Accession)

Molecular Weight

Approximately 33.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p21 (CDKN1A) Human Gene Knockout Kit (CRISPR)
KN201765BN 1 Kit

p21 (CDKN1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Centrin 1 (CETN1) Mouse Monoclonal Antibody [Clone ID: OTI9D2]
CF804238 100 µg

Centrin 1 (CETN1) Mouse Monoclonal Antibody [Clone ID: OTI9D2]

Sign In for Pricing
View Details
Avobenzone
TRC-A794690-1G 1 g

Avobenzone

Sign In for Pricing
View Details
OR1L8 Human Gene Knockout Kit (CRISPR)
KN424016 1 Kit

OR1L8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C4orf33 (NM_001099783) Human Over-expression Lysate
LY420533 100 µg

C4orf33 (NM_001099783) Human Over-expression Lysate

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS4), Biotin conjugate, 0.1mg/mL
BNCB1744-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details