Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STUB1, Human

STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90) . STUB1 Protein, Human is the recombinant human-derived STUB1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

STUB1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stub1-protein-human.html

Purity

98.0

Smiles

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Molecular Formula

10273 (Gene_ID) Q9UNE7 (M1-Y303) (Accession)

Molecular Weight

Approximately 33.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUBP3 Mouse Monoclonal Antibody [Clone ID: OTI4D8]
CF812223 100 µg

FUBP3 Mouse Monoclonal Antibody [Clone ID: OTI4D8]

Sign In for Pricing
View Details
Screw-cap MicroCentrifuge Tubes
C3175-R 1000 Units/Case

Screw-cap MicroCentrifuge Tubes

Sign In for Pricing
View Details
NPIP (NPIPA1) Human Gene Knockout Kit (CRISPR)
KN419505 1 Kit

NPIP (NPIPA1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-Bromo-2H-1,4-benzoxazin-3(4H)-one
TRC-B680345-1G 1 g

6-Bromo-2H-1,4-benzoxazin-3(4H)-one

Sign In for Pricing
View Details
8-epi-PGF2α (8-Epi-Prostaglandin F2 Alpha) ELISA Kit
E-EL-0041-01 24 Tests

8-epi-PGF2α (8-Epi-Prostaglandin F2 Alpha) ELISA Kit

Sign In for Pricing
View Details
8-epi-PGF2α (8-Epi-Prostaglandin F2 Alpha) ELISA Kit
E-EL-0041-02 48 Tests

8-epi-PGF2α (8-Epi-Prostaglandin F2 Alpha) ELISA Kit

Sign In for Pricing
View Details