Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STUB1, Human

STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90) . STUB1 Protein, Human is the recombinant human-derived STUB1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

STUB1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stub1-protein-human.html

Purity

98.0

Smiles

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Molecular Formula

10273 (Gene_ID) Q9UNE7 (M1-Y303) (Accession)

Molecular Weight

Approximately 33.0 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XTP4 (MIEN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]
TA504583AM 100 µL

XTP4 (MIEN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS805477 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Plfr CRISPR/Cas9 KO Plasmid (m)
sc-422306 20 µg

Plfr CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
MED16 ORF Vector (Human) (pORF)
ORF006361 1.0 µg DNA

MED16 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Olopatadine HCl
C16876-01 10 mM / 1 mL

Olopatadine HCl

Sign In for Pricing
View Details
Olopatadine HCl
C16876-02 50 mg

Olopatadine HCl

Sign In for Pricing
View Details