Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF RII/TNFRSF1B, Human (HEK293, His)

TNFRII (TNFRSF1B) protein has a high ability to bind with tumor necrosis factor-alpha (TNF-α) . TNFRII has pro-apoptotic function. TNFRII recruits TRAF2, induces gene expression and intensively crosstalks with TNF-R1. TNFRII selectively enhances the induction of apoptosis by the death receptor TNFRI. TNF RII/TNFRSF1B Protein, Human (HEK293, His) is expressed by HEK293 with His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNF RII/TNFRSF1B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-rii-tnfrsf1b-protein-human-hek293-his.html

Purity

95.0

Smiles

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Molecular Formula

7133 (Gene_ID) P20333-1 (L23-D257) (Accession)

Molecular Weight

Approximately 40.1 kDa

References & Citations

[1]Wajant H, et, al. Tumor necrosis factor signaling. Cell Death Differ. 2003 Jan;10 (1) :45-65.|[2]Fotin-Mleczek M, et, al. Apoptotic crosstalk of TNF receptors: TNF-R2-induces depletion of TRAF2 and IAP proteins and accelerates TNF-R1-dependent activation of caspase-8. J Cell Sci. 2002 Jul 1;115 (Pt 13) :2757-70.|[3]Masli S, et, al. Anti-inflammatory effects of tumour necrosis factor (TNF) -alpha are mediated via TNF-R2 (p75) in tolerogenic transforming growth factor-beta-treated antigen-presenting cells. Immunology. 2009 May;127 (1) :62-72.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcitonin (CALCA) Rabbit Polyclonal Antibody
TA364031 50 µL

Calcitonin (CALCA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human β-Arrestin 1/ARRB1 Protein (His Tag)
PKSH033262-01 10 µg

Recombinant Human β-Arrestin 1/ARRB1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human β-Arrestin 1/ARRB1 Protein (His Tag)
PKSH033262-02 50 µg

Recombinant Human β-Arrestin 1/ARRB1 Protein (His Tag)

Sign In for Pricing
View Details
Solvent Red 25 (Technical Grade)
TRC-S676745-500MG 500 mg

Solvent Red 25 (Technical Grade)

Sign In for Pricing
View Details
Zalcitabine-13C,15N2
TRC-Z140002-50MG 50 mg

Zalcitabine-13C,15N2

Sign In for Pricing
View Details
17-Hydroxy-17-(1-propynyl)-estra-4,9-dien-3-one
TRC-H947166-2.5MG 2.5 mg

17-Hydroxy-17-(1-propynyl)-estra-4,9-dien-3-one

Sign In for Pricing
View Details