Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Mouse (HEK293, Fc)

HMGB1, or high mobility group box 1, is a protein that plays a role in various cellular processes. It has different functionalities depending on its redox state and location within the cell. HMGB1/HMG-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived HMGB1/HMG-1 protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-mouse-hek293-fc.html

Purity

98.0

Smiles

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE

Molecular Formula

15289 (Gene_ID) P63158 (M1-E215) (Accession)

Molecular Weight

Approximately 57-59.24 kDa

References & Citations

Cell Mol Biol Lett. 2024 May 16;29(1):75.|J Neuroimmunol. 2024 Jul 18:394:578403.|SSRN. 2024 Mar 26.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Citation 01

Cell Mol Biol Lett. 2024 May 16;29 (1) :75.|J Neuroimmunol. 2024 Jul 18:394:578403.|Acta Pharm Sin B. 2025 Apr;15 (4) :2077-2094.|Redox Biol. 2025 Sep 22:87:103877.|Sci Rep. 2025 Jun 6;15 (1) :19871.|Sci Rep. 2025 May 29;15 (1) :18853.|SSRN. 2024 Mar 26.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AFAP1 protein
orb1292382-01 50 µg

Human AFAP1 protein

Sign In for Pricing
View Details
Human AFAP1 protein
orb1292382-02 100 µg

Human AFAP1 protein

Sign In for Pricing
View Details
Human AFAP1 protein
orb1292382-03 200 µg

Human AFAP1 protein

Sign In for Pricing
View Details
Human AFAP1 protein
orb1292382-04 1 mg

Human AFAP1 protein

Sign In for Pricing
View Details
PARP1 Rabbit Polyclonal Antibody (HRP)
orb474627 100 µL

PARP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ERK1 (Phospho-pT202/pY204)+Erk2 (Phospho-pT185/pY187) Antibody
MBS9431038-01 0.05 mL

ERK1 (Phospho-pT202/pY204)+Erk2 (Phospho-pT185/pY187) Antibody

Sign In for Pricing
View Details