Aminopeptidase P2, Human (HEK293, His)
Aminopeptidase P2 Protein, Human (HEK293, His), a recombinant human Aminopeptidase P2 produced in HEK293 cells, has a His tag at the C-terminus. Aminopeptidase P2 is an aminoacylproline hydrolase that specifically removes the N-terminal amino acid from peptides with a penultimate prolyl residue[1].
Product Specifications
Product Name Alternative
Aminopeptidase P2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/aminopeptidase-p2-protein-human-hek293-his.html
Smiles
HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAAHHHHHH
Molecular Formula
7512 (Gene_ID) O43895 (H22-A650) (Accession)
Molecular Weight
Approximately 78 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Erşahin C, et al. Aminopeptidase P isozyme expression in human tissues and peripheral blood mononuclear cell fractions. Arch Biochem Biophys. 2005 Mar 15;435 (2) :303-10.|[2]Li F, et al. XPNPEP2 is associated with lymph node metastasis in prostate cancer patients. Sci Rep. 2019 Jul 11;9 (1) :10078.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
133350-PE 100 µL
SIM2 (Single-minded Homolog 2, Class E Basic Helix-loop-helix Protein 15, bHLHe15, BHLHE15, MGC119447) (PE)
Sign In for Pricing
View Details 
041644-APC 200 µL
SFXN1, CT (SFXN1, Sideroflexin-1, Tricarboxylate carrier protein) (APC) discontinued
Sign In for Pricing
View Details MBS7032932-01 0.02 mg
Recombinant Bifidobacterium longum subsp. infantis Undecaprenyl-diphosphatase (uppP)
Sign In for Pricing
View Details MBS7032932-02 0.1 mg
Recombinant Bifidobacterium longum subsp. infantis Undecaprenyl-diphosphatase (uppP)
Sign In for Pricing
View Details MBS7032932-03 5x 0.1 mg
Recombinant Bifidobacterium longum subsp. infantis Undecaprenyl-diphosphatase (uppP)
Sign In for Pricing
View Details