Aminopeptidase P2, Human (HEK293, His)

Aminopeptidase P2 Protein, Human (HEK293, His), a recombinant human Aminopeptidase P2 produced in HEK293 cells, has a His tag at the C-terminus. Aminopeptidase P2 is an aminoacylproline hydrolase that specifically removes the N-terminal amino acid from peptides with a penultimate prolyl residue[1].

Product Specifications

Product Name Alternative

Aminopeptidase P2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aminopeptidase-p2-protein-human-hek293-his.html

Smiles

HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAAHHHHHH

Molecular Formula

7512 (Gene_ID) O43895 (H22-A650) (Accession)

Molecular Weight

Approximately 78 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Erşahin C, et al. Aminopeptidase P isozyme expression in human tissues and peripheral blood mononuclear cell fractions. Arch Biochem Biophys. 2005 Mar 15;435 (2) :303-10.|[2]Li F, et al. XPNPEP2 is associated with lymph node metastasis in prostate cancer patients. Sci Rep. 2019 Jul 11;9 (1) :10078.