Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aminopeptidase P2, Human (HEK293, His)

Aminopeptidase P2 Protein, Human (HEK293, His), a recombinant human Aminopeptidase P2 produced in HEK293 cells, has a His tag at the C-terminus. Aminopeptidase P2 is an aminoacylproline hydrolase that specifically removes the N-terminal amino acid from peptides with a penultimate prolyl residue[1].

Product Specifications

Product Name Alternative

Aminopeptidase P2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/aminopeptidase-p2-protein-human-hek293-his.html

Smiles

HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAAHHHHHH

Molecular Formula

7512 (Gene_ID) O43895 (H22-A650) (Accession)

Molecular Weight

Approximately 78 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Erşahin C, et al. Aminopeptidase P isozyme expression in human tissues and peripheral blood mononuclear cell fractions. Arch Biochem Biophys. 2005 Mar 15;435 (2) :303-10.|[2]Li F, et al. XPNPEP2 is associated with lymph node metastasis in prostate cancer patients. Sci Rep. 2019 Jul 11;9 (1) :10078.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDE10A knockdown cell line
ABC-KD11299 1 Vial

Human PDE10A knockdown cell line

Sign In for Pricing
View Details
Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)
MBS1184941-01 0.02 mg (E-Coli)

Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)

Sign In for Pricing
View Details
Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)
MBS1184941-02 0.02 mg (Yeast)

Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)

Sign In for Pricing
View Details
Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)
MBS1184941-03 0.1 mg (E-Coli)

Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)

Sign In for Pricing
View Details
Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)
MBS1184941-04 0.1 mg (Yeast)

Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)

Sign In for Pricing
View Details
Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)
MBS1184941-05 0.02 mg (Baculovirus)

Recombinant Halothermothrix orenii D-alanine--D-alanine ligase (ddl)

Sign In for Pricing
View Details