Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Activin beta-C chain, partial

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey Activin beta-C chain protein, partial

UniProt

G7PIV0

Expression Region

237-352aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

GIDCQEGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHVAGMPGIAASFHTAVLNLLKANTAAGTTGGSSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS

Tag

C-terminal 10xHis-HSA-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

81.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM55B Lentiviral Activation Particles (h2)
sc-410227-LAC-2 200 µL

TMEM55B Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
FMO5 CRISPRa sgRNA lentivector (set of three targets)(Human)
20696121 3x 1.0µg DNA

FMO5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Lentiviral human COTL1 shRNA (UAS) - Lentiviral human COTL1 shRNA (UAS, RFP) (100)
GTR15317907 1 Vial

Lentiviral human COTL1 shRNA (UAS) - Lentiviral human COTL1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-HK3 Antibody Picoband® PE Conjugated
A05145-3-PE 100 µg/Vial

Anti-HK3 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Rat Monoclonal Pax5/BSAP Antibody (1H9) [Alexa Fluor 532]
NBP2-00258AF532 0.1 mL

Rat Monoclonal Pax5/BSAP Antibody (1H9) [Alexa Fluor 532]

Sign In for Pricing
View Details
CD14 discontinued
C2265-35 200 µg

CD14 discontinued

Sign In for Pricing
View Details