Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Mouse (His)

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

Product Specifications

Product Name Alternative

EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-mouse-his.html

Purity

98.0

Smiles

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

9-14 kDa

References & Citations

[1]Chen JX, et al. Involvement of c-Src/STAT3 signal in EGF-induced proliferation of rat spermatogonial stem cells. Mol Cell Biochem. 2011 Dec;358 (1-2) :67-73.|[2]Guo Y, et al. Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer. Oncol Rep. 2012 Jan;27 (1) :286-92. |[3]Kim S, et al. Smad7 acts as a negative regulator of the epidermal growth factor (EGF) signaling pathway in breast cancer cells. Cancer Lett. 2012 Jan 28;314 (2) :147-54.|[4]Chatterton RT Jr, et al. Breast ductal lavage for assessment of breast cancer biomarkers. Horm Cancer. 2010 Aug;1 (4) :197-204.|[5]Schlessinger J, et al. Regulation of cell proliferation by epidermal growth factor. CRC Crit Rev Biochem. 1983;14 (2) :93-111.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taar4 Mouse Gene Knockout Kit (CRISPR)
KN517105 1 Kit

Taar4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SLC19A2 Human Gene Knockout Kit (CRISPR)
KN416515 1 Kit

SLC19A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-Chloro-1-butanol (Technical Grade)
TRC-C367830-50G 50 g

4-Chloro-1-butanol (Technical Grade)

Sign In for Pricing
View Details
GRAF (ARHGAP26) Rabbit Monoclonal Antibody
TA424349 100 µL

GRAF (ARHGAP26) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
4-BEC Hydrochloride
TRC-B130000-25MG 25 mg

4-BEC Hydrochloride

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF405S conjugate, 0.1mg/mL
BNC041384-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1384), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details