Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Mouse (His)

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

Product Specifications

Product Name Alternative

EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-mouse-his.html

Purity

98.0

Smiles

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

9-14 kDa

References & Citations

[1]Chen JX, et al. Involvement of c-Src/STAT3 signal in EGF-induced proliferation of rat spermatogonial stem cells. Mol Cell Biochem. 2011 Dec;358 (1-2) :67-73.|[2]Guo Y, et al. Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer. Oncol Rep. 2012 Jan;27 (1) :286-92. |[3]Kim S, et al. Smad7 acts as a negative regulator of the epidermal growth factor (EGF) signaling pathway in breast cancer cells. Cancer Lett. 2012 Jan 28;314 (2) :147-54.|[4]Chatterton RT Jr, et al. Breast ductal lavage for assessment of breast cancer biomarkers. Horm Cancer. 2010 Aug;1 (4) :197-204.|[5]Schlessinger J, et al. Regulation of cell proliferation by epidermal growth factor. CRC Crit Rev Biochem. 1983;14 (2) :93-111.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Azacytidine
SIH-345-250MG 250 mg

5-Azacytidine

Sign In for Pricing
View Details
NR0B1 (NM_000475) Human Over-expression Lysate
LY424702 100 µg

NR0B1 (NM_000475) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXA1 Recombinant Mouse Monoclonal Antibody [A2E8-R]
HA601298 100 µL

FOXA1 Recombinant Mouse Monoclonal Antibody [A2E8-R]

Sign In for Pricing
View Details
Mouse Ftl1 activation kit by CRISPRa
GA201483 1 Kit

Mouse Ftl1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD68 Recombinant Rabbit Monoclonal Antibody [PSH05-47]
HA722285 100 µL

CD68 Recombinant Rabbit Monoclonal Antibody [PSH05-47]

Sign In for Pricing
View Details
CD200 (NM_005944) Human Over-expression Lysate
LC401799 20 µg

CD200 (NM_005944) Human Over-expression Lysate

Sign In for Pricing
View Details