Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EGF, Mouse (His)

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

Product Specifications

Product Name Alternative

EGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/egf-protein-mouse-his.html

Purity

98.0

Smiles

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Molecular Formula

13645 (Gene_ID) P01132 (N977-R1029) (Accession)

Molecular Weight

9-14 kDa

References & Citations

[1]Chen JX, et al. Involvement of c-Src/STAT3 signal in EGF-induced proliferation of rat spermatogonial stem cells. Mol Cell Biochem. 2011 Dec;358 (1-2) :67-73.|[2]Guo Y, et al. Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer. Oncol Rep. 2012 Jan;27 (1) :286-92. |[3]Kim S, et al. Smad7 acts as a negative regulator of the epidermal growth factor (EGF) signaling pathway in breast cancer cells. Cancer Lett. 2012 Jan 28;314 (2) :147-54.|[4]Chatterton RT Jr, et al. Breast ductal lavage for assessment of breast cancer biomarkers. Horm Cancer. 2010 Aug;1 (4) :197-204.|[5]Schlessinger J, et al. Regulation of cell proliferation by epidermal growth factor. CRC Crit Rev Biochem. 1983;14 (2) :93-111.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC9 (NM_014441) Human Recombinant Protein
TP306674 20 µg

SIGLEC9 (NM_014441) Human Recombinant Protein

Sign In for Pricing
View Details
SUZ12 Rabbit Monoclonal Antibody
TA422854 100 µL

SUZ12 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
JAK2 (Ab-931) Antibody
8B8118-AAT 50 µg

JAK2 (Ab-931) Antibody

Sign In for Pricing
View Details
Lrp2 / Megalin Recombinant Rabbit monoclonal Antibody
HA750846 100 µL

Lrp2 / Megalin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SSCP Stop Solution (Haz Fee)
EC-848 1.2 mL

SSCP Stop Solution (Haz Fee)

Sign In for Pricing
View Details
SIN1 (MAPKAP1) Rabbit Polyclonal Antibody
TA378321 100 µL

SIN1 (MAPKAP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details