Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Moorella thermoacetica Formamidopyrimidine-DNA glycosylase (mutM)

Product Specifications

CAS Number

9000-83-3

Gene Name

[mutM]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[mutM; Fapy-DNA glycosylase; AP lyase MutM]

Short Name

[Formamidopyrimidine-DNA glycosylase (mutM)]

Other Product Names

[formamidopyrimidine-DNA glycosylase; Formamidopyrimidine-DNA glycosylase; DNA-(apurinic or apyrimidinic site) lyase MutM]

NCBI GI Number

499712606

NCBI Accession Number

WP_011393340.1

NCBI GB Accession Number

WP_011393340.1

Uniprot Accession Number

Q2RHE9

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
HY-P3431 1 Each

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
CD24 Rabbit Polyclonal Antibody
E28PT0741 100 µL

CD24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAM18 Polyclonal Antibody, Cy3 Conjugated
bs-5849R-Cy3 100 µL

ADAM18 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
SPATS1 Recombinant Protein Antigen
NBP2-55558PEP 100 µL

SPATS1 Recombinant Protein Antigen

Sign In for Pricing
View Details
C6orf226 (NM_001008739) Human Over-expression Lysate
LS441150-100ug 100 µg

C6orf226 (NM_001008739) Human Over-expression Lysate

Sign In for Pricing
View Details
CLDN23 Blocking Peptide
MBS9628416-01 1 mg

CLDN23 Blocking Peptide

Sign In for Pricing
View Details