Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1/CD277, Human (HEK293, His)

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A1/CD277 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a1-cd277-protein-human-hek-293-his.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Molecular Formula

11119 (Gene_ID) O00481-1 (Q30-G254) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasminogen Activator Inhibitor 1 (PAI-1) Peptide
PE-55196-01 1 mg

Plasminogen Activator Inhibitor 1 (PAI-1) Peptide

Sign In for Pricing
View Details
Plasminogen Activator Inhibitor 1 (PAI-1) Peptide
PE-55196-02 5 mg

Plasminogen Activator Inhibitor 1 (PAI-1) Peptide

Sign In for Pricing
View Details
Plasminogen Activator Inhibitor 1 (PAI-1) Peptide
PE-55196-03 10 mg

Plasminogen Activator Inhibitor 1 (PAI-1) Peptide

Sign In for Pricing
View Details
Rat PIM3 shRNA Plasmid
abx986282-01 150 µg

Rat PIM3 shRNA Plasmid

Sign In for Pricing
View Details
Rat PIM3 shRNA Plasmid
abx986282-02 300 µg

Rat PIM3 shRNA Plasmid

Sign In for Pricing
View Details
NCRNA00110 CRISPRa sgRNA lentivector (set of three targets)(Human)
62546121 3x 1.0µg DNA

NCRNA00110 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details