Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1/CD277, Human (HEK293, His)

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A1/CD277 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a1-cd277-protein-human-hek-293-his.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Molecular Formula

11119 (Gene_ID) O00481-1 (Q30-G254) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Campylobacter Jejuni hemA Protein (aa 1-432) (strain RM1221)
VAng-Ly2665-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni hemA Protein (aa 1-432) (strain RM1221)

Sign In for Pricing
View Details
Fluor 647-conjugated beta actin Monoclonal Antibody
MBS2578797-01 0.025 mL

Fluor 647-conjugated beta actin Monoclonal Antibody

Sign In for Pricing
View Details
Fluor 647-conjugated beta actin Monoclonal Antibody
MBS2578797-02 0.1 mL

Fluor 647-conjugated beta actin Monoclonal Antibody

Sign In for Pricing
View Details
Fluor 647-conjugated beta actin Monoclonal Antibody
MBS2578797-03 5x 0.1 mL

Fluor 647-conjugated beta actin Monoclonal Antibody

Sign In for Pricing
View Details
PRDM13 siRNA (Mouse)
CRN2774-01 15 nmol

PRDM13 siRNA (Mouse)

Sign In for Pricing
View Details
PRDM13 siRNA (Mouse)
CRN2774-02 30 nmol

PRDM13 siRNA (Mouse)

Sign In for Pricing
View Details