Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1/CD277, Human (HEK293, His)

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A1/CD277 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a1-cd277-protein-human-hek-293-his.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Molecular Formula

11119 (Gene_ID) O00481-1 (Q30-G254) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH12 (NM_004061) Human Tagged ORF Clone Lentiviral Particle
RC208156L2V 200 µL

CDH12 (NM_004061) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human AVL9 Pre-designed siRNA Set B
SI001353B 1 Each

Human AVL9 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Slc25a44 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
44034114 3x 1.0 µg

Slc25a44 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
DACH2, NT (DACH2, Dachshund homolog 2)
034457 200 µL

DACH2, NT (DACH2, Dachshund homolog 2)

Sign In for Pricing
View Details
Twinfilin-2 (TWF2, A6-related Protein, A6r, A6RP, hA6RP, MSTP011, Protein Tyrosine Kinase 9-like, PTK9L, Twinfilin-1-like Protein) (Biotin)
MBS6397646-01 0.1 mL

Twinfilin-2 (TWF2, A6-related Protein, A6r, A6RP, hA6RP, MSTP011, Protein Tyrosine Kinase 9-like, PTK9L, Twinfilin-1-like Protein) (Biotin)

Sign In for Pricing
View Details
Twinfilin-2 (TWF2, A6-related Protein, A6r, A6RP, hA6RP, MSTP011, Protein Tyrosine Kinase 9-like, PTK9L, Twinfilin-1-like Protein) (Biotin)
MBS6397646-02 5x 0.1 mL

Twinfilin-2 (TWF2, A6-related Protein, A6r, A6RP, hA6RP, MSTP011, Protein Tyrosine Kinase 9-like, PTK9L, Twinfilin-1-like Protein) (Biotin)

Sign In for Pricing
View Details