Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1/CD277, Human (HEK293, His)

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A1/CD277 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a1-cd277-protein-human-hek-293-his.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Molecular Formula

11119 (Gene_ID) O00481-1 (Q30-G254) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNK (Cyclin K)
477402 100 µL

CCNK (Cyclin K)

Sign In for Pricing
View Details
Sodium Acetate Anhydrous ExiPlus, Multi-Compendial, 99%
51483 500 g

Sodium Acetate Anhydrous ExiPlus, Multi-Compendial, 99%

Sign In for Pricing
View Details
NDP protein (His tag)
80R-2996 50 ug

NDP protein (His tag)

Sign In for Pricing
View Details
LOC100362591 3'UTR Luciferase Stable Cell Line
TU208384 1.0 mL

LOC100362591 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Anti-Human HSPB1 (aa 76-80) Polyclonal Antibody
CPB-1126RH 100 ul

Rabbit Anti-Human HSPB1 (aa 76-80) Polyclonal Antibody

Sign In for Pricing
View Details
0.1mL Corbett Style 4-Strip Tubes, with
PCR-COR-01 250/Box

0.1mL Corbett Style 4-Strip Tubes, with

Sign In for Pricing
View Details