Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1/CD277, Human (HEK293, His)

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A1/CD277 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a1-cd277-protein-human-hek-293-his.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Molecular Formula

11119 (Gene_ID) O00481-1 (Q30-G254) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-) -Didesoxycannabidiol-d9
163785 1 mg

(-) -Didesoxycannabidiol-d9

Sign In for Pricing
View Details
Recombinant Human Programmed cell death protein 6
MBS9421690-01 0.02 mg

Recombinant Human Programmed cell death protein 6

Sign In for Pricing
View Details
Recombinant Human Programmed cell death protein 6
MBS9421690-02 0.1 mg

Recombinant Human Programmed cell death protein 6

Sign In for Pricing
View Details
Recombinant Human Programmed cell death protein 6
MBS9421690-03 1 mg

Recombinant Human Programmed cell death protein 6

Sign In for Pricing
View Details
Recombinant Human Programmed cell death protein 6
MBS9421690-04 5x 1 mg

Recombinant Human Programmed cell death protein 6

Sign In for Pricing
View Details
Human Anoctamin 7 (ANO7) ELISA Kit
QY-E05148 96 Tests

Human Anoctamin 7 (ANO7) ELISA Kit

Sign In for Pricing
View Details