Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTN3A1/CD277, Human (HEK293, His)

BTN3A1/CD277 Protein, functioning as a homodimer, regulates activated T-cell proliferation, controls cytokine release, and mediates T-cell response to cells with elevated phosphorylated metabolites, such as isopentenyl pyrophosphate, contributing to T-cell activation and the adaptive immune response. BTN3A1/CD277 Protein, Human (HEK293, His) is the recombinant human-derived BTN3A1/CD277 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

BTN3A1/CD277 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/btn3a1-cd277-protein-human-hek-293-his.html

Smiles

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Molecular Formula

11119 (Gene_ID) O00481-1 (Q30-G254) (Accession)

Molecular Weight

Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dazap2 Mouse qPCR Primer Pair (NM_011873)
MP203371 200 Reactions

Dazap2 Mouse qPCR Primer Pair (NM_011873)

Sign In for Pricing
View Details
CDK4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV671115 1.0 µg DNA

CDK4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
RBMXL2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62673R-BF594-01 20 µL

RBMXL2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
RBMXL2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62673R-BF594-02 100 µL

RBMXL2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Caprisil C1 HPLC Column, 3 µm, 100 Å, CY533-C1 x 75 mm
CY433-C1 3 µm

Caprisil C1 HPLC Column, 3 µm, 100 Å, CY533-C1 x 75 mm

Sign In for Pricing
View Details
Human CD122/IL2RB Recombinant Protein
PPT-11128 100 µg

Human CD122/IL2RB Recombinant Protein

Sign In for Pricing
View Details