Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD157, Rat (HEK293, His)

CD157 protein catalyzes the synthesis of cADPR from NAD (+) and hydrolyzes cADPR to ADPR. cADPR acts as a second messenger, releasing calcium from intracellular stores. CD157 protein may also contribute to pre-B cell growth. CD157 Protein, Rat (HEK293, His) is the recombinant rat-derived CD157 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD157 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd157-protein-rat-hek293-his.html

Purity

95.0

Smiles

RWSGEGTTPHLQSIFLGRCAEYTTLLSLEPGNKNCTAIWEAFKVVLDKDPCSVLPSDYDLFINLSRHAIPRDKSLFWENNHLLVMSYAENTRRLMPLCDVLYGKVGDFLSWCRQENASGLDYQSCPTAEDCENNAVDAYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTKGFFADFEIPYLQKDKITRIEIWVMHEVGGPHVESCGEGSVKILEDRLEALGFQHSCINDYPPVKFLMCVDHSTHPDCAMNSASASMWRE

Molecular Formula

81506 (Gene_ID) Q63072 (R34-E293) (Accession)

Molecular Weight

Approximately 33-45 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adrenocorticotropic Hormone (ACTH) ELISA Kit
K072-H5 5 Plates

Adrenocorticotropic Hormone (ACTH) ELISA Kit

Sign In for Pricing
View Details
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF405S conjugate, 0.1mg/mL
BNC042314-100 1x 100 µL

P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRIM19 (NDUFA13) Rabbit Polyclonal Antibody
TA369153 100 µL

GRIM19 (NDUFA13) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene A HMPA
HA140015.25G 25 g

Polystyrene A HMPA

Sign In for Pricing
View Details
Sec8 (EXOC4) Mouse Monoclonal Antibody [Clone ID: OTI1E9]
CF811242 100 µg

Sec8 (EXOC4) Mouse Monoclonal Antibody [Clone ID: OTI1E9]

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS641889 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details