Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD157, Rat (HEK293, His)

CD157 protein catalyzes the synthesis of cADPR from NAD (+) and hydrolyzes cADPR to ADPR. cADPR acts as a second messenger, releasing calcium from intracellular stores. CD157 protein may also contribute to pre-B cell growth. CD157 Protein, Rat (HEK293, His) is the recombinant rat-derived CD157 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD157 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd157-protein-rat-hek293-his.html

Purity

95.0

Smiles

RWSGEGTTPHLQSIFLGRCAEYTTLLSLEPGNKNCTAIWEAFKVVLDKDPCSVLPSDYDLFINLSRHAIPRDKSLFWENNHLLVMSYAENTRRLMPLCDVLYGKVGDFLSWCRQENASGLDYQSCPTAEDCENNAVDAYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTKGFFADFEIPYLQKDKITRIEIWVMHEVGGPHVESCGEGSVKILEDRLEALGFQHSCINDYPPVKFLMCVDHSTHPDCAMNSASASMWRE

Molecular Formula

81506 (Gene_ID) Q63072 (R34-E293) (Accession)

Molecular Weight

Approximately 33-45 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galanin (GAL) Human Gene Knockout Kit (CRISPR)
KN207053RB 1 Kit

Galanin (GAL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p53 DINP1 (TP53INP1) (NM_001135733) Human Over-expression Lysate
LY427688 100 µg

p53 DINP1 (TP53INP1) (NM_001135733) Human Over-expression Lysate

Sign In for Pricing
View Details
OR5W2 Antibody
8G657-AAT 50 µg

OR5W2 Antibody

Sign In for Pricing
View Details
ETS1 (NM_005238) Human Over-expression Lysate
LY401606 100 µg

ETS1 (NM_005238) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human NECTIN4 Protein (Sumo Tag)
PDEH100662-01 20 µg

Recombinant Human NECTIN4 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human NECTIN4 Protein (Sumo Tag)
PDEH100662-02 100 µg

Recombinant Human NECTIN4 Protein (Sumo Tag)

Sign In for Pricing
View Details