MMP-1, Human (HEK293, C-His)
The MMP-1 protein acts as an enzyme capable of cleaving types I, II, and III collagen at specific sites within the helical domain. In addition, it exhibits lytic activity against type VII and type X collagen. MMP-1 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-1, expressed by HEK293, with C-6*His labeled tag.
Product Specifications
Product Name Alternative
MMP-1 Protein, Human (HEK293, C-His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mmp-1-protein-human-hek293-c-his.html
Purity
98.0
Smiles
FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Molecular Formula
4312 (Gene_ID) P03956 (F20-N469) (Accession)
Molecular Weight
Approximately 56 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040040-100 1x 100 µL
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880096-500 1x 500 µL
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400674-500 1x 500 µL
Cytokeratin 10 (LH2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041777-100 1x 100 µL
Prostate Specific Antigen (PSA) (3E6), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details