Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HER2/CD340, Human (Domain 4, HEK293, His)

The HER2/CD340 protein is a dynamic tyrosine kinase that is essential in the neuregulin receptor complex and regulates microtubule dynamics. Upon activation, it triggers the MEMO1-RHOA-DIAPH1 pathway, inhibits GSK3B and promotes the association of APC and CLASP2 on the cell membrane to achieve microtubule stabilization. HER2/CD340 Protein, Human (142a.a, HEK293, His) is the recombinant human-derived HER2/CD340 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HER2/CD340 Protein, Human (Domain 4, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/her2-cd340-protein-human-142a-a-hek293-his.html

Purity

93.00

Smiles

PHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC

Molecular Formula

2064 (Gene_ID) P04626-1/NP_004439.2 (P489-C630) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNFRSF4 Antibody
A18623-50UG 50 µg

TNFRSF4 Antibody

Ask
View Details
SDHB Protein (N-His, Human)
P508190 100 µg

SDHB Protein (N-His, Human)

Ask
View Details
TMEM150C Human shRNA Lentiviral Particle (Locus ID 441027)
TL320222V 500 µL Each

TMEM150C Human shRNA Lentiviral Particle (Locus ID 441027)

Ask
View Details
TDS Std 1382ppm NaCl at 25C
CS1382 500 mL

TDS Std 1382ppm NaCl at 25C

Ask
View Details
Lentiviral human SMIM29 shRNA (UAS) - Lentiviral human SMIM29 shRNA (UAS) plasmid
GTR15097879 1 Vial

Lentiviral human SMIM29 shRNA (UAS) - Lentiviral human SMIM29 shRNA (UAS) plasmid

Ask
View Details
NMDA 2b Receptor, phosphorylated (Tyr1472) (NMDA R2b, N-methyl-D-aspartate, GRIN2B, Glutamate receptor ionotropic N-methyl D-aspartate 2B, HGNC:4586, NR2B, hNR3, N-methyl-D-aspartate receptor subunit 2B) (HRP) discontinued
N2904-35D1-HRP 100 µL

NMDA 2b Receptor, phosphorylated (Tyr1472) (NMDA R2b, N-methyl-D-aspartate, GRIN2B, Glutamate receptor ionotropic N-methyl D-aspartate 2B, HGNC:4586, NR2B, hNR3, N-methyl-D-aspartate receptor subunit 2B) (HRP) discontinued

Ask
View Details