HER2/CD340, Human (Domain 4, HEK293, His)
The HER2/CD340 protein is a dynamic tyrosine kinase that is essential in the neuregulin receptor complex and regulates microtubule dynamics. Upon activation, it triggers the MEMO1-RHOA-DIAPH1 pathway, inhibits GSK3B and promotes the association of APC and CLASP2 on the cell membrane to achieve microtubule stabilization. HER2/CD340 Protein, Human (142a.a, HEK293, His) is the recombinant human-derived HER2/CD340 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
HER2/CD340 Protein, Human (Domain 4, HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/her2-cd340-protein-human-142a-a-hek293-his.html
Purity
93.00
Smiles
PHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC
Molecular Formula
2064 (Gene_ID) P04626-1/NP_004439.2 (P489-C630) (Accession)
Molecular Weight
Approximately 27 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
EIF3CL, NT (EIF3C, EIF3S8, Eukaryotic translation initiation factor 3 subunit C, Eukaryotic translation initiation factor 3 subunit 8, eIF3 p110) (MaxLight 405)
EIF3CL, NT (EIF3C, EIF3S8, Eukaryotic translation initiation factor 3 subunit C, Eukaryotic translation initiation factor 3 subunit 8, eIF3 p110) (MaxLight 405)
