Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HER2/CD340, Human (Domain 4, HEK293, His)

The HER2/CD340 protein is a dynamic tyrosine kinase that is essential in the neuregulin receptor complex and regulates microtubule dynamics. Upon activation, it triggers the MEMO1-RHOA-DIAPH1 pathway, inhibits GSK3B and promotes the association of APC and CLASP2 on the cell membrane to achieve microtubule stabilization. HER2/CD340 Protein, Human (142a.a, HEK293, His) is the recombinant human-derived HER2/CD340 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

HER2/CD340 Protein, Human (Domain 4, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/her2-cd340-protein-human-142a-a-hek293-his.html

Purity

93.00

Smiles

PHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC

Molecular Formula

2064 (Gene_ID) P04626-1/NP_004439.2 (P489-C630) (Accession)

Molecular Weight

Approximately 27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-500 1x 500 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2910), CF740 conjugate, 0.1mg/mL
BNC742910-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2910), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), CF594 conjugate, 0.1mg/mL
BNC941813-100 1x 100 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), 0.2mg/mL
BNUB0806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), 0.2mg/mL

Sign In for Pricing
View Details
PS2 (TFF1/1091), CF647 conjugate, 0.1mg/mL
BNC471091-100 1x 100 µL

PS2 (TFF1/1091), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details