EMAP-II, Human
Product Specifications
UNSPSC Description
EMAP-II Protein, Human is a proinflammatory cytokine and chemoattractant of macrophages.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/emap-ii-protein-human.html
Smiles
SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Molecular Weight
Approximately 18.2 kDa
References & Citations
[1]Schluesener HJ, et al. Localization of endothelial-monocyte-activating polypeptide II (EMAP II), a novel proinflammatory cytokine, to lesions of experimental autoimmune encephalomyelitis, neuritis and uveitis: expression by monocytes and activated microglial cells. Glia. 1997 Aug;20(4):365-72.|[2]Barnett G, et al. Prostate adenocarcinoma cells release the novel proinflammatory polypeptide EMAP-II in response to stress. Cancer Res. 2000 Jun 1;60(11):2850-7.
Shipping Conditions
Room temperature
More Discoveries
Explore Other Products
Browse additional items from our catalog