EMAP-II, Human

Product Specifications

UNSPSC Description

EMAP-II Protein, Human is a proinflammatory cytokine and chemoattractant of macrophages.

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/emap-ii-protein-human.html

Smiles

SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK

Molecular Weight

Approximately 18.2 kDa

References & Citations

[1]Schluesener HJ, et al. Localization of endothelial-monocyte-activating polypeptide II (EMAP II), a novel proinflammatory cytokine, to lesions of experimental autoimmune encephalomyelitis, neuritis and uveitis: expression by monocytes and activated microglial cells. Glia. 1997 Aug;20(4):365-72.|[2]Barnett G, et al. Prostate adenocarcinoma cells release the novel proinflammatory polypeptide EMAP-II in response to stress. Cancer Res. 2000 Jun 1;60(11):2850-7.