Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG1A, Cynomolgus (HEK293, His)

REG1A Protein serves as an inhibitor of spontaneous calcium carbonate precipitation. REG1A Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived REG1A protein, expressed by HEK293 , with C-His labeled tag. REG1A Protein, Cynomolgus (HEK293, His), has molecular weight of ~19 & 21 kDa, respectively.

Product Specifications

Product Name Alternative

REG1A Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg1a-protein-cynomolgus-hek293-his.html

Purity

97.00

Smiles

QEAQTDLPQARISCPEGSNAYGSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWTGLHDPKKNRRWHWSSGSLVSYKSWDIGAPNSVNPGYCVSLTSSSGFRKWKDVPCEDKFSFVCKFKN

Molecular Formula

/ (Gene_ID) G8F4F8 (Q23-N166) (Accession)

Molecular Weight

Approximately 17&20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPT2 Protein Vector (Human) (pPM-C-HA)
22618021 500 ng

GPT2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
OPCA03016-500UG - IL10 Recombinant Protein
OPCA03016-500UG 500 µg

OPCA03016-500UG - IL10 Recombinant Protein

Sign In for Pricing
View Details
Thrb Mouse siRNA Oligo Duplex (Locus ID 21834)
SR415382 1 Kit

Thrb Mouse siRNA Oligo Duplex (Locus ID 21834)

Sign In for Pricing
View Details
Spon2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4843807 1.0 µg DNA

Spon2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
OBFC2B (NABP2) (NM_024068) Human Tagged ORF Clone
RC200876 10 µg

OBFC2B (NABP2) (NM_024068) Human Tagged ORF Clone

Sign In for Pricing
View Details
GPA33 protein, Human, Recombinant (His)
E51P90820 20 µg

GPA33 protein, Human, Recombinant (His)

Sign In for Pricing
View Details