Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-A, Human (His)

HLA-A protein is an antigen-presenting MHCI molecule that is critical for mediating reproductive and antiviral immunity. It partners with B2M to provide self- and viral peptides as ligands that inhibit and activate KIR on NK cells. HLA-A Protein, Human (His) is the recombinant human-derived HLA-A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

HLA-A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-a-human-his.html

Purity

91.00

Smiles

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

Molecular Formula

3105 (Gene_ID) P04439-1 (G25-I308) (Accession)

Molecular Weight

Approximately 36.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Amphiregulin ELISA Kit
MBS9424890-01 96 Tests

Human Amphiregulin ELISA Kit

Sign In for Pricing
View Details
Human Amphiregulin ELISA Kit
MBS9424890-02 5x 96 Tests

Human Amphiregulin ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit
MBS4502876-01 48 Tests

Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit
MBS4502876-02 96 Tests

Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit
MBS4502876-03 5x 96 Tests

Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit

Sign In for Pricing
View Details
Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit
MBS4502876-04 10x 96 Tests

Mouse Tyrosine Kinase With Immunoglobulin Like And EGF Like Domains Protein 1 (Tie1) ELISA Kit

Sign In for Pricing
View Details