Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRABP2, Mouse (His)

CRABP2 is an important mediator that promotes intracellular retinoic acid transport and regulates its contact with nuclear retinoic acid receptors. This key role is essential for the cellular processes controlled by retinoic acid. CRABP2 Protein, Mouse (His) is the recombinant mouse-derived CRABP2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CRABP2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/crabp2-protein-mouse-his.html

Purity

98.0

Smiles

PNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE

Molecular Formula

12904 (Gene_ID) P22935 (P2-E138) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(-) -Lentiginosine
HY-117910-01 500 µg

(-) -Lentiginosine

Sign In for Pricing
View Details
(-) -Lentiginosine
HY-117910-02 1 mg

(-) -Lentiginosine

Sign In for Pricing
View Details
(-) -Lentiginosine
HY-117910-03 2.5 mg

(-) -Lentiginosine

Sign In for Pricing
View Details
Ubxn6 (NM_024432) Mouse Recombinant Protein
TP507042 20 µg

Ubxn6 (NM_024432) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant Anoxybacillus flavithermus Histidinol-phosphate aminotransferase (hisC)
MBS1009582-01 0.02 mg (E-Coli)

Recombinant Anoxybacillus flavithermus Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details
Recombinant Anoxybacillus flavithermus Histidinol-phosphate aminotransferase (hisC)
MBS1009582-02 0.02 mg (Yeast)

Recombinant Anoxybacillus flavithermus Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details