Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPOX Antibody
E51A06028 100 µL

PPOX Antibody

Sign In for Pricing
View Details
Lentiviral mouse Oprl1 shRNA (UAS) - Lentiviral mouse Oprl1 shRNA (UAS) plasmid
GTR15278719 1 Vial

Lentiviral mouse Oprl1 shRNA (UAS) - Lentiviral mouse Oprl1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal CCL23/Ck beta 8-1/MIP3 Antibody (CCL23/4034) [DyLight 405]
NBP3-27008V 0.1 mL

Mouse Monoclonal CCL23/Ck beta 8-1/MIP3 Antibody (CCL23/4034) [DyLight 405]

Sign In for Pricing
View Details
pCMV-Fbxl3-MBP-Neo Plasmid
PVT59032 2 µg

pCMV-Fbxl3-MBP-Neo Plasmid

Sign In for Pricing
View Details
Crybg3 3'UTR GFP Stable Cell Line
TU154405 1.0 mL

Crybg3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HMGN1P27 Protein Vector (Human) (pPB-N-His)
PV083742 500 ng

HMGN1P27 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details