Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP5 (Charged Multivesicular Body Protein 5)
477957 100 µL

CHMP5 (Charged Multivesicular Body Protein 5)

Sign In for Pricing
View Details
ZC3H11A AAV Vector (Mouse) (CMV)
50735104 1 µg

ZC3H11A AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Dnaja3 sgRNA CRISPR Lentivector set (Mouse)
K4390001 3x 1.0 µg

Dnaja3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Microthrix parvicella One-Step PCR kit
Oneq-A575-150D 150 Reactions

Microthrix parvicella One-Step PCR kit

Sign In for Pricing
View Details
Mouse TENC1 shRNA Plasmid
abx980596-01 150 µg

Mouse TENC1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse TENC1 shRNA Plasmid
abx980596-02 300 µg

Mouse TENC1 shRNA Plasmid

Sign In for Pricing
View Details