Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tree Shrews Anesthesia Adaptor Kit
68076 1 PC

Tree Shrews Anesthesia Adaptor Kit

Sign In for Pricing
View Details
Rabbit Polyclonal DIA1 Antibody
NBP3-10632-100ul 100 µL

Rabbit Polyclonal DIA1 Antibody

Sign In for Pricing
View Details
CD38 inhibitor 78c
6391/5 5 mg

CD38 inhibitor 78c

Sign In for Pricing
View Details
Recombinant Mouse Proteasome subunit beta type-9 (Psmb9)
MBS950025-01 0.02 mg (E-Coli)

Recombinant Mouse Proteasome subunit beta type-9 (Psmb9)

Sign In for Pricing
View Details
Recombinant Mouse Proteasome subunit beta type-9 (Psmb9)
MBS950025-02 0.1 mg (E-Coli)

Recombinant Mouse Proteasome subunit beta type-9 (Psmb9)

Sign In for Pricing
View Details
Recombinant Mouse Proteasome subunit beta type-9 (Psmb9)
MBS950025-03 0.02 mg (Yeast)

Recombinant Mouse Proteasome subunit beta type-9 (Psmb9)

Sign In for Pricing
View Details