Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Annexin A8 Recombinant Protein Tag Free Lyophilized
MBS8431208-01 0.05 mg

Human Annexin A8 Recombinant Protein Tag Free Lyophilized

Sign In for Pricing
View Details
Human Annexin A8 Recombinant Protein Tag Free Lyophilized
MBS8431208-02 5x 0.05 mg

Human Annexin A8 Recombinant Protein Tag Free Lyophilized

Sign In for Pricing
View Details
Chromatography Packing Adsorbents, SiO2,40-70um,100A, spherical,200g/pk
13101045 200 g

Chromatography Packing Adsorbents, SiO2,40-70um,100A, spherical,200g/pk

Sign In for Pricing
View Details
CD79a
CR396-0.1ml 0.1 mL

CD79a

Sign In for Pricing
View Details
Lmbrd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6285708 1.0 µg DNA

Lmbrd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Ckap4 shRNA (UAS) - Lentiviral mouse Ckap4 shRNA (UAS, RFP) plasmid
GTR15195025 1 Vial

Lentiviral mouse Ckap4 shRNA (UAS) - Lentiviral mouse Ckap4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details