Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Grep1 Pre-designed siRNA Set A
SI205912A 1 Each

Rat Grep1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human Follistatin-Related Protein 3 (FSTL3) Protein
abx620212-01 100 µg

Human Follistatin-Related Protein 3 (FSTL3) Protein

Sign In for Pricing
View Details
Human Follistatin-Related Protein 3 (FSTL3) Protein
abx620212-02 1 mg

Human Follistatin-Related Protein 3 (FSTL3) Protein

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SKP1
MBS8527559-01 0.1 mL

Mouse Monoclonal Antibody to SKP1

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SKP1
MBS8527559-02 0.1 mL (AF405L)

Mouse Monoclonal Antibody to SKP1

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to SKP1
MBS8527559-03 0.1 mL (AF405S)

Mouse Monoclonal Antibody to SKP1

Sign In for Pricing
View Details