Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMFG Rabbit pAb
E47R13457 100 µL

GMFG Rabbit pAb

Sign In for Pricing
View Details
Hofer’s Alkaline Medium
M717-100G 100 g

Hofer’s Alkaline Medium

Sign In for Pricing
View Details
RDX (Radixin, DFNB24) (Biotin)
MBS6170535-01 0.1 mL

RDX (Radixin, DFNB24) (Biotin)

Sign In for Pricing
View Details
RDX (Radixin, DFNB24) (Biotin)
MBS6170535-02 5x 0.1 mL

RDX (Radixin, DFNB24) (Biotin)

Sign In for Pricing
View Details
Human Nucleoporin 107Kda NUP107 ELISA Kit
BG-HUM11563 1 Each

Human Nucleoporin 107Kda NUP107 ELISA Kit

Sign In for Pricing
View Details
CD162 (CD162 Antigen, P-Selectin Glycoprotein Ligand 1 Precursor, PSGL 1, PSGL1, PSGL-1, Selectin P ligand, SELPLG) discontinued
C2548-89R 200 µg

CD162 (CD162 Antigen, P-Selectin Glycoprotein Ligand 1 Precursor, PSGL 1, PSGL1, PSGL-1, Selectin P ligand, SELPLG) discontinued

Sign In for Pricing
View Details