Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit C4a ELISA Kit
ERTC0666 96 Tests

Rabbit C4a ELISA Kit

Sign In for Pricing
View Details
KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (Biotin)
MBS6424254-01 0.1 mL

KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (Biotin)

Sign In for Pricing
View Details
KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (Biotin)
MBS6424254-02 5x 0.1 mL

KRT4 (Cytokeratin 4, Keratin 4, K4, CK4, CK-4, CYK4) (Biotin)

Sign In for Pricing
View Details
USP8 (NM_001128610) Human Tagged Lenti ORF Clone
RC226336L3 10 µg

USP8 (NM_001128610) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human SPI1 siRNA
abx905245-01 15 nmol

Human SPI1 siRNA

Sign In for Pricing
View Details
Human SPI1 siRNA
abx905245-02 30 nmol

Human SPI1 siRNA

Sign In for Pricing
View Details