Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-500 1x 500 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details