Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (His) is the recombinant mouse-derived SCGB1A1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-96F) (Accession)

Molecular Weight

Approximately 9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Integrin alpha V beta 3 Antibody (2549B) [Janelia Fluor 585]
FAB12192JF585 0.1 mL

Rabbit Monoclonal Integrin alpha V beta 3 Antibody (2549B) [Janelia Fluor 585]

Sign In for Pricing
View Details
C2orf48 (NM_182626) Human Tagged ORF Clone Lentiviral Particle
RC210907L4V 200 µL

C2orf48 (NM_182626) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Aldose reductase-IN-1
MBS3601455-01 2 mg

Aldose reductase-IN-1

Sign In for Pricing
View Details
Aldose reductase-IN-1
MBS3601455-02 5 mg

Aldose reductase-IN-1

Sign In for Pricing
View Details
Aldose reductase-IN-1
MBS3601455-03 10 mg

Aldose reductase-IN-1

Sign In for Pricing
View Details
Aldose reductase-IN-1
MBS3601455-04 25 mg

Aldose reductase-IN-1

Sign In for Pricing
View Details