Carbonic Anhydrase 14, Mouse (His)
Carbonic Anhydrase 14 Protein, Mouse (His) is an approximately 40.0 kDa mouse carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system[1].
Product Specifications
Product Name Alternative
Carbonic Anhydrase 14 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carbonic-anhydrase-14-protein-mouse-his.html
Smiles
HHHHHHADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Molecular Formula
23831 (Gene_ID) Q9WVT6 (A16-M290) (Accession)
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]K Fujikawa-Adachi, et al. Human carbonic anhydrase XIV (CA14) : cDNA cloning, mRNA expression, and mapping to chromosome 1. Genomics. 1999 Oct 1;61 (1) :74-81.|[2]D Hewett-Emmett, et al. Functional diversity, conservation, and convergence in the evolution of the alpha-, beta-, and gamma-carbonic anhydrase gene families. Mol Phylogenet Evol
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
