Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 14, Mouse (His)

Carbonic Anhydrase 14 Protein, Mouse (His) is an approximately 40.0 kDa mouse carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system[1].

Product Specifications

Product Name Alternative

Carbonic Anhydrase 14 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-14-protein-mouse-his.html

Smiles

HHHHHHADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM

Molecular Formula

23831 (Gene_ID) Q9WVT6 (A16-M290) (Accession)

Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]K Fujikawa-Adachi, et al. Human carbonic anhydrase XIV (CA14) : cDNA cloning, mRNA expression, and mapping to chromosome 1. Genomics. 1999 Oct 1;61 (1) :74-81.|[2]D Hewett-Emmett, et al. Functional diversity, conservation, and convergence in the evolution of the alpha-, beta-, and gamma-carbonic anhydrase gene families. Mol Phylogenet Evol

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C3orf26 CRISPR Activation Plasmid (h2)
sc-413629-ACT-2 20 µg

C3orf26 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Catenin-γ Antibody
orb193232-01 50 μL

Catenin-γ Antibody

Sign In for Pricing
View Details
Catenin-γ Antibody
orb193232-02 100 µL

Catenin-γ Antibody

Sign In for Pricing
View Details
CXADRP3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
17163151 3x 1.0 µg DNA

CXADRP3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rat STOML2 shRNA Plasmid
abx988911-01 150 µg

Rat STOML2 shRNA Plasmid

Sign In for Pricing
View Details
Rat STOML2 shRNA Plasmid
abx988911-02 300 µg

Rat STOML2 shRNA Plasmid

Sign In for Pricing
View Details