Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13R alpha 2, Rat (HEK293, His)

IL-13R alpha 2 Protein, functioning as a monomer, exhibits strong affinity for binding to interleukin-13 (IL-13), thereby playing a crucial role in mediating the biological effects of IL-13 and regulating various cellular processes. IL-13R alpha 2 Protein, Rat (HEK293, His) is the recombinant rat-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-13R alpha 2 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13r-alpha-2-protein-rat-hek293-his.html

Purity

98.0

Smiles

LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVMDNFKECKLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWTEASYGIADEGSLGTKIQDMKCIYYNWQYLVCSWKPGKTVHSDTNYTMFFWYEGLDHALQCADYLQDNEKNVGCKLSNLDSSDYKDFFIRVNGSSKLEPIRSSYMVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPSCYTYEIVVREDDISWESATDKNDMKLKRRANESEDLCFFVRCKINIYCADDGIWSEWSEEECWEGYTGPDSK

Molecular Formula

171060 (Gene_ID) Q8VHK6 (L24-K336) (Accession)

Molecular Weight

Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GRAMD2B Protein
E30P8822 20 µg

Recombinant Human GRAMD2B Protein

Sign In for Pricing
View Details
SFRP4 Rabbit mAb
E45R12926N-50 50 µL

SFRP4 Rabbit mAb

Sign In for Pricing
View Details
TNIP2 (NM_024309) Human Tagged ORF Clone
RG201339 10 µg

TNIP2 (NM_024309) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cat A Disintegrin and Metalloproteinase With Thrombospondin 5 ELISA Kit
MBS052071 Inquire

Cat A Disintegrin and Metalloproteinase With Thrombospondin 5 ELISA Kit

Sign In for Pricing
View Details
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1633 (AF_1633), partial
MBS7069988 Inquire

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1633 (AF_1633), partial

Sign In for Pricing
View Details
Raf-1 (phospho Ser338) Polyclonal Antibody
MBS9242220-01 0.1 mL

Raf-1 (phospho Ser338) Polyclonal Antibody

Sign In for Pricing
View Details