Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tryptase beta-2 (TPSB2)

Product Specifications

Product Name Alternative

Tryptase II

Abbreviation

Recombinant Human TPSB2 protein

Gene Name

TPSB2

UniProt

P20231

Expression Region

31-275aa

Organism

Homo sapiens (Human)

Target Sequence

IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP

Tag

C-terminal 6xHis-Myc-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Biochemicals

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOL6 (NM_139235) Human Untagged Clone
SC314464 10 µg

NOL6 (NM_139235) Human Untagged Clone

Sign In for Pricing
View Details
CNDP1 Human shRNA Plasmid Kit (Locus ID 84735)
TL305335 1 Kit

CNDP1 Human shRNA Plasmid Kit (Locus ID 84735)

Sign In for Pricing
View Details
C18 AB-D C18 5um 150 x 4.6mm - EACH
CHR4852 1 Each

C18 AB-D C18 5um 150 x 4.6mm - EACH

Sign In for Pricing
View Details
Allergin-1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-7348R-APC-Cy7 100 µL

Allergin-1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Human CD152 protein, C-His Tag
MBS157982-01 0.05 mg

Recombinant Human CD152 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human CD152 protein, C-His Tag
MBS157982-02 0.1 mg

Recombinant Human CD152 protein, C-His Tag

Sign In for Pricing
View Details