Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Can f 4, Canine (HEK293, His)

Can f 4 Protein, Canine (HEK293, His), an IgE-binding dog dander protein, is an important respiratory allergen. Can f 4 Protein is a dog allergen of the lipocalin family[1]. Can f 4 Protein, Canine (HEK293, His) is the recombinant canine-derived Can f 4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Can f 4 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/canf4-protein-canine-hek293-his.html

Purity

95.00

Smiles

QLPLPNVLTQVSGPWKTLYISSNNLDKIGDNGPFRIYMRGINVDIPRLKMSFNFYVKVDGECVENSVGASIGRDNLIKGEYNGGNYFRIIDMTPNALIGYDVNVDSKGKITKVALLMGRGAHVNEEDIAKFKKLSREKGIPEENIIYLGDTDNCPNHE

Molecular Formula

100463491 (Gene_ID) NP_001177855.1 (Q17-E174) (Accession)

Molecular Weight

Approximately 19 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Insulin-like peptide INSL6 (INSL6), partial
orb3004435-01 20 µg

Recombinant Human Insulin-like peptide INSL6 (INSL6), partial

Sign In for Pricing
View Details
Recombinant Human Insulin-like peptide INSL6 (INSL6), partial
orb3004435-02 100 µg

Recombinant Human Insulin-like peptide INSL6 (INSL6), partial

Sign In for Pricing
View Details
Recombinant Human Insulin-like peptide INSL6 (INSL6), partial
orb3004435-03 1 mg

Recombinant Human Insulin-like peptide INSL6 (INSL6), partial

Sign In for Pricing
View Details
Rabbit Polyclonal FKBP25 Antibody [DyLight 594]
NBP3-00022DL594 0.1 mL

Rabbit Polyclonal FKBP25 Antibody [DyLight 594]

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Transforming Growth Factor Beta 2 (TGFb2)
MBS2039613-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Transforming Growth Factor Beta 2 (TGFb2)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Transforming Growth Factor Beta 2 (TGFb2)
MBS2039613-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Transforming Growth Factor Beta 2 (TGFb2)

Sign In for Pricing
View Details