Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT4, Human (HEK293, His)

B4GALT4 Protein, Human (HEK293, His) encodes a type II membrane protein with significant sequence similarity to other β1,4-galactosyltransferases. B4GALT4 mainly plays a role in glycolipid biosynthesis and has been recognized involving in cancer metastatic processes[1][2].

Product Specifications

Product Name Alternative

B4GALT4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b4galt4-protein-human-hek293-his.html

Smiles

QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAHHHHHH

Molecular Formula

8702 (Gene_ID) O60513 (Q39-A344) (Accession)

Molecular Weight

Approximately 34-43 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]H Zhou, et al. B4GALT family mediates the multidrug resistance of human leukemia cells by regulating the hedgehog pathway and the expression of p-glycoprotein and multidrug resistance-associated protein 1. ell Death Dis. 2013 Jun 6;4 (6) :e654.|[2]T Schwientek, et al. Cloning of a novel member of the UDP-galactose:beta-N-acetylglucosamine beta1,4-galactosyltransferase family, beta4Gal-T4, involved in glycosphingolipid biosynthesis. J Biol Chem. 1998 Nov 6;273 (45) :29331-40.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMYA5 rabbit pAb
UB-GEN-11414 100 µL

CMYA5 rabbit pAb

Sign In for Pricing
View Details
Nalgene Nylon MF75 250ml 0.2um Filter Unit
FIL8112 12 / PCK

Nalgene Nylon MF75 250ml 0.2um Filter Unit

Sign In for Pricing
View Details
Card9 Mouse qPCR Primer Pair (NM_001037747)
MP219934 200 Reactions

Card9 Mouse qPCR Primer Pair (NM_001037747)

Sign In for Pricing
View Details
Recombinant Opistophthalmus carinatus Potassium channel toxin alpha-KTx 6.6
MBS7089130-01 0.02 mg (E-Coli)

Recombinant Opistophthalmus carinatus Potassium channel toxin alpha-KTx 6.6

Sign In for Pricing
View Details
Recombinant Opistophthalmus carinatus Potassium channel toxin alpha-KTx 6.6
MBS7089130-02 0.1 mg (E-Coli)

Recombinant Opistophthalmus carinatus Potassium channel toxin alpha-KTx 6.6

Sign In for Pricing
View Details
Recombinant Opistophthalmus carinatus Potassium channel toxin alpha-KTx 6.6
MBS7089130-03 0.02 mg (Yeast)

Recombinant Opistophthalmus carinatus Potassium channel toxin alpha-KTx 6.6

Sign In for Pricing
View Details