B4GALT4, Human (HEK293, His)

B4GALT4 Protein, Human (HEK293, His) encodes a type II membrane protein with significant sequence similarity to other β1,4-galactosyltransferases. B4GALT4 mainly plays a role in glycolipid biosynthesis and has been recognized involving in cancer metastatic processes[1][2].

Product Specifications

Product Name Alternative

B4GALT4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b4galt4-protein-human-hek293-his.html

Smiles

QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAHHHHHH

Molecular Formula

8702 (Gene_ID) O60513 (Q39-A344) (Accession)

Molecular Weight

Approximately 34-43 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]H Zhou, et al. B4GALT family mediates the multidrug resistance of human leukemia cells by regulating the hedgehog pathway and the expression of p-glycoprotein and multidrug resistance-associated protein 1. ell Death Dis. 2013 Jun 6;4 (6) :e654.|[2]T Schwientek, et al. Cloning of a novel member of the UDP-galactose:beta-N-acetylglucosamine beta1,4-galactosyltransferase family, beta4Gal-T4, involved in glycosphingolipid biosynthesis. J Biol Chem. 1998 Nov 6;273 (45) :29331-40.