Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALT4, Human (HEK293, His)

B4GALT4 Protein, Human (HEK293, His) encodes a type II membrane protein with significant sequence similarity to other β1,4-galactosyltransferases. B4GALT4 mainly plays a role in glycolipid biosynthesis and has been recognized involving in cancer metastatic processes[1][2].

Product Specifications

Product Name Alternative

B4GALT4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b4galt4-protein-human-hek293-his.html

Smiles

QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAHHHHHH

Molecular Formula

8702 (Gene_ID) O60513 (Q39-A344) (Accession)

Molecular Weight

Approximately 34-43 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]H Zhou, et al. B4GALT family mediates the multidrug resistance of human leukemia cells by regulating the hedgehog pathway and the expression of p-glycoprotein and multidrug resistance-associated protein 1. ell Death Dis. 2013 Jun 6;4 (6) :e654.|[2]T Schwientek, et al. Cloning of a novel member of the UDP-galactose:beta-N-acetylglucosamine beta1,4-galactosyltransferase family, beta4Gal-T4, involved in glycosphingolipid biosynthesis. J Biol Chem. 1998 Nov 6;273 (45) :29331-40.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elmod2 Mouse shRNA Plasmid (Locus ID 244548)
TR510687 1 Kit

Elmod2 Mouse shRNA Plasmid (Locus ID 244548)

Sign In for Pricing
View Details
Lentiviral human PHF2 shRNA (UAS) - Lentiviral human PHF2 shRNA (UAS, RFP) (25)
GTR15095987 1 Vial

Lentiviral human PHF2 shRNA (UAS) - Lentiviral human PHF2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Mouse GTF3C5 shRNA Plasmid
abx977156-01 150 µg

Mouse GTF3C5 shRNA Plasmid

Sign In for Pricing
View Details
Mouse GTF3C5 shRNA Plasmid
abx977156-02 300 µg

Mouse GTF3C5 shRNA Plasmid

Sign In for Pricing
View Details
Zgpat (NM_001048148) Mouse Tagged ORF Clone Lentiviral Particle
MR208212L3V 200 µL

Zgpat (NM_001048148) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Proteinase 3 (PR3, cANCA) Antibody
16781-05011 150 µg

Human Proteinase 3 (PR3, cANCA) Antibody

Sign In for Pricing
View Details