B4GALT4, Human (HEK293, His)
B4GALT4 Protein, Human (HEK293, His) encodes a type II membrane protein with significant sequence similarity to other β1,4-galactosyltransferases. B4GALT4 mainly plays a role in glycolipid biosynthesis and has been recognized involving in cancer metastatic processes[1][2].
Product Specifications
Product Name Alternative
B4GALT4 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b4galt4-protein-human-hek293-his.html
Smiles
QEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGAHHHHHH
Molecular Formula
8702 (Gene_ID) O60513 (Q39-A344) (Accession)
Molecular Weight
Approximately 34-43 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]H Zhou, et al. B4GALT family mediates the multidrug resistance of human leukemia cells by regulating the hedgehog pathway and the expression of p-glycoprotein and multidrug resistance-associated protein 1. ell Death Dis. 2013 Jun 6;4 (6) :e654.|[2]T Schwientek, et al. Cloning of a novel member of the UDP-galactose:beta-N-acetylglucosamine beta1,4-galactosyltransferase family, beta4Gal-T4, involved in glycosphingolipid biosynthesis. J Biol Chem. 1998 Nov 6;273 (45) :29331-40.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040029-100 1x 100 µL
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680994-100 1x 100 µL
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470460-100 1x 100 µL
CD44 Standard (156-3C11), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
