IL-11 Protein, Human (CHO)
IL-11 Protein, Human (CHO) is a CHO cell derived protective factor, which has a protective role and can accelerate recovery of platelets, and remarkably lessen the extent of inflammatory responses.
Product Specifications
Product Name Alternative
IL-11 Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-11-protein-human-cho.html
Purity
95.00
Smiles
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Molecular Formula
3589 (Gene_ID) P20809-1 (P22-L199) (Accession)
Molecular Weight
Approximately 23 kDa
References & Citations
[1]Wan B, et al. Recombinant human interleukin-11 (IL-11) is a protective factor in severe sepsis with thrombocytopenia: A case-control study. Cytokine. 2015 Dec;76 (2) :138-143.|[2]Weich NS, et al. Recombinant human interleukin-11 directly promotes megakaryocytopoiesis in vitro. Blood. 1997 Nov 15;90 (10) :3893-902.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6418521-01 0.1 mL
GJB3 (Gap Junction Beta 3 Protein, EKV, Connexin-31, CX31, DFNA2, DFNA2B) (AP)
Sign In for Pricing
View Details MBS6418521-02 5x 0.1 mL
GJB3 (Gap Junction Beta 3 Protein, EKV, Connexin-31, CX31, DFNA2, DFNA2B) (AP)
Sign In for Pricing
View Details 
E5-00086 100 µg
Heat-stress-induced ribosome- binding protein A Protein
Sign In for Pricing
View Details