Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-011 Protein, His Tag
MOP2194 50 µg

Recombinant Mouse IL-011 Protein, His Tag

Sign In for Pricing
View Details
Human GLIS2 Pre-designed siRNA Set B
SI006304B 1 Each

Human GLIS2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CMP-N-acetylneuraminate-β-galactosamide-α-2,3-sialyltransferase 4 (ST3GAL4) Human ELISA Kit
C4264 96 Tests

CMP-N-acetylneuraminate-β-galactosamide-α-2,3-sialyltransferase 4 (ST3GAL4) Human ELISA Kit

Sign In for Pricing
View Details
Plasmid-derived Single-stranded DNA-binding Protein, Recombinant, E. coli, aa2-179, His-SUMO-Tag
585797-01 20 µg

Plasmid-derived Single-stranded DNA-binding Protein, Recombinant, E. coli, aa2-179, His-SUMO-Tag

Sign In for Pricing
View Details
Plasmid-derived Single-stranded DNA-binding Protein, Recombinant, E. coli, aa2-179, His-SUMO-Tag
585797-02 100 µg

Plasmid-derived Single-stranded DNA-binding Protein, Recombinant, E. coli, aa2-179, His-SUMO-Tag

Sign In for Pricing
View Details
Recombinant ASFV Pret-033 Protein (aa 1-353)
VAng-2326Lsx-50g 50 µg

Recombinant ASFV Pret-033 Protein (aa 1-353)

Sign In for Pricing
View Details