Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCF-STTG1
C0005032 One Frozen Vial

CCF-STTG1

Sign In for Pricing
View Details
Pectin Lyase Activity Assay Kit
AK0193-50T-48S 50 Tests - 48 Samples

Pectin Lyase Activity Assay Kit

Sign In for Pricing
View Details
Lentiviral human CEP83 sgRNA gene knockout kit - Lentiviral human CEP83 sgRNA gene knockout kit (plasmid)
GTR15371987 1 Vial

Lentiviral human CEP83 sgRNA gene knockout kit - Lentiviral human CEP83 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Metoxuron
TRC-M338843-50MG 50 mg

Metoxuron

Sign In for Pricing
View Details
Horse HSP-70/HSPA9 (HeatShock Protein 70) ELISA Kit
EK248739 96 Well

Horse HSP-70/HSPA9 (HeatShock Protein 70) ELISA Kit

Sign In for Pricing
View Details
TNIP2 Rabbit Polyclonal Antibody
E53P11284 100 µL

TNIP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details