Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DPEP2 Antibody [Alexa Fluor 532]
NBP3-00197AF532 0.1 mL

Rabbit Polyclonal DPEP2 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Lentiviral human ZNF236 sgRNA gene knockout kit - Lentiviral human ZNF236 sgRNA gene knockout kit (100)
GTR15373783 1 Vial

Lentiviral human ZNF236 sgRNA gene knockout kit - Lentiviral human ZNF236 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
KCNG3 (Potassium Voltage-gated Channel Subfamily G Member 3, Voltage-gated Potassium Channel Subunit Kv10.1, Voltage-gated Potassium Channel Subunit Kv6.3) (HRP)
128740-HRP 100 µL

KCNG3 (Potassium Voltage-gated Channel Subfamily G Member 3, Voltage-gated Potassium Channel Subunit Kv10.1, Voltage-gated Potassium Channel Subunit Kv6.3) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Itfg1 shRNA (UAS) - Lentiviral mouse Itfg1 shRNA (UAS, RFP) (100)
GTR15299415 1 Vial

Lentiviral mouse Itfg1 shRNA (UAS) - Lentiviral mouse Itfg1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human Cholinesterase (BCHE) ELISA Kit
MBS7253559-01 48 Well

Human Cholinesterase (BCHE) ELISA Kit

Sign In for Pricing
View Details
Human Cholinesterase (BCHE) ELISA Kit
MBS7253559-02 96 Well

Human Cholinesterase (BCHE) ELISA Kit

Sign In for Pricing
View Details