Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECMV-3xFLAG-HPS1 (1Synonymous mutation)
BZ13779 1 Vial

PECMV-3xFLAG-HPS1 (1Synonymous mutation)

Sign In for Pricing
View Details
RING Finger Protein 103 (RNF103, E3 Ubiquitin-protein Ligase RNF103, KF1, KF-1, hKF-1, Zinc Finger Protein 103 Homolog, ZFP103, Zfp-103) APC
MBS6138751-01 0.1 mL

RING Finger Protein 103 (RNF103, E3 Ubiquitin-protein Ligase RNF103, KF1, KF-1, hKF-1, Zinc Finger Protein 103 Homolog, ZFP103, Zfp-103) APC

Sign In for Pricing
View Details
RING Finger Protein 103 (RNF103, E3 Ubiquitin-protein Ligase RNF103, KF1, KF-1, hKF-1, Zinc Finger Protein 103 Homolog, ZFP103, Zfp-103) APC
MBS6138751-02 5x 0.1 mL

RING Finger Protein 103 (RNF103, E3 Ubiquitin-protein Ligase RNF103, KF1, KF-1, hKF-1, Zinc Finger Protein 103 Homolog, ZFP103, Zfp-103) APC

Sign In for Pricing
View Details
Recombinant Mycobacterium Smegmatis ppc Protein (aa 1-933)
VAng-Yyj4767-inquire Inquire

Recombinant Mycobacterium Smegmatis ppc Protein (aa 1-933)

Sign In for Pricing
View Details
SMA5 siRNA (h)
sc-92040 10 µM

SMA5 siRNA (h)

Sign In for Pricing
View Details
PCDH1, NT (PCDH1, Protocadherin-1, Cadherin-like protein 1, Protocadherin-42) (PE) discontinued
039722-PE 200 µL

PCDH1, NT (PCDH1, Protocadherin-1, Cadherin-like protein 1, Protocadherin-42) (PE) discontinued

Sign In for Pricing
View Details