Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit
MBS457672-01 48 Tests

Rat Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit

Sign In for Pricing
View Details
Rat Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit
MBS457672-02 96 Tests

Rat Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit

Sign In for Pricing
View Details
Rat Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit
MBS457672-03 5x 96 Tests

Rat Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit

Sign In for Pricing
View Details
Rat Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit
MBS457672-04 10x 96 Tests

Rat Apoptotic Peptidase Activating Factor 1 (APAF1) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Zea mays (Maize) HRGP Polyclonal Antibody
MBS7152469 Inquire

Rabbit anti-Zea mays (Maize) HRGP Polyclonal Antibody

Sign In for Pricing
View Details
ZNF563 Over-expression Lysate Product
GWB-912D62 0.1 mg

ZNF563 Over-expression Lysate Product

Sign In for Pricing
View Details