Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal EZH2/KMT6 Antibody (CL11915)
NBP3-21204-100ul 100 µL

Mouse Monoclonal EZH2/KMT6 Antibody (CL11915)

Sign In for Pricing
View Details
N-Ethyl-Tetrahydro-2H-pyran-4-amine ≥97% (GC)
240030-01 250 mg

N-Ethyl-Tetrahydro-2H-pyran-4-amine ≥97% (GC)

Sign In for Pricing
View Details
N-Ethyl-Tetrahydro-2H-pyran-4-amine ≥97% (GC)
240030-02 1 g

N-Ethyl-Tetrahydro-2H-pyran-4-amine ≥97% (GC)

Sign In for Pricing
View Details
N-Ethyl-Tetrahydro-2H-pyran-4-amine ≥97% (GC)
240030-03 5 g

N-Ethyl-Tetrahydro-2H-pyran-4-amine ≥97% (GC)

Sign In for Pricing
View Details
STAT4 antibody
70R-37487 100 ug

STAT4 antibody

Sign In for Pricing
View Details
Human C4a des Arg Anaphylatoxin (Natural)
PE71139 1 Vial

Human C4a des Arg Anaphylatoxin (Natural)

Sign In for Pricing
View Details