Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synuclein, alpha, Phosphorylated (Y133) (SNCA, Alpha-synuclein, PD1, NACP, PARK1, PARK4) (Biotin)
MBS6439764-01 0.1 mL

Synuclein, alpha, Phosphorylated (Y133) (SNCA, Alpha-synuclein, PD1, NACP, PARK1, PARK4) (Biotin)

Sign In for Pricing
View Details
Synuclein, alpha, Phosphorylated (Y133) (SNCA, Alpha-synuclein, PD1, NACP, PARK1, PARK4) (Biotin)
MBS6439764-02 5x 0.1 mL

Synuclein, alpha, Phosphorylated (Y133) (SNCA, Alpha-synuclein, PD1, NACP, PARK1, PARK4) (Biotin)

Sign In for Pricing
View Details
Sulfo-NHS-LC-Biotin sodium
MBS5799838 Inquire

Sulfo-NHS-LC-Biotin sodium

Sign In for Pricing
View Details
Rfxank (NM_001025589) Mouse Tagged Lenti ORF Clone
MR203366L4 10 µg

Rfxank (NM_001025589) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse TUBB5 siRNA
abx938571-01 15 nmol

Mouse TUBB5 siRNA

Sign In for Pricing
View Details
Mouse TUBB5 siRNA
abx938571-02 30 nmol

Mouse TUBB5 siRNA

Sign In for Pricing
View Details