Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2S) -6-Prenylnaringenin
MF-0002681-01 1 mg

(2S) -6-Prenylnaringenin

Sign In for Pricing
View Details
(2S) -6-Prenylnaringenin
MF-0002681-02 5 mg

(2S) -6-Prenylnaringenin

Sign In for Pricing
View Details
(2S) -6-Prenylnaringenin
MF-0002681-03 1 mL - 10 mM (in DMSO)

(2S) -6-Prenylnaringenin

Sign In for Pricing
View Details
(2S) -6-Prenylnaringenin
MF-0002681-04 10 mg

(2S) -6-Prenylnaringenin

Sign In for Pricing
View Details
(2S) -6-Prenylnaringenin
MF-0002681-05 25 mg

(2S) -6-Prenylnaringenin

Sign In for Pricing
View Details
Research Grade Anti-Human HGF (YYB101)
DHD03705 100 μg

Research Grade Anti-Human HGF (YYB101)

Sign In for Pricing
View Details