Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Rat (P. pastoris, His)

FGF-23 protein is a key regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It also modulates vitamin D metabolism, negatively regulates osteoblast differentiation and matrix mineralization, and reduces parathyroid hormone secretion from the parathyroid glands. FGF-23 Protein, Rat (P. pastoris, His) is the recombinant rat-derived FGF-23 protein, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-23 Protein, Rat (P. pastoris, His), Rat, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-rat-p-pastoris-his.html

Smiles

YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Molecular Formula

170583 (Gene_ID) Q8VI82 (Y25-V251) (Accession)

Molecular Weight

27.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4galnt1 (NM_022860) Rat Tagged Lenti ORF Clone
RR200805L4 10 µg

B4galnt1 (NM_022860) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PRDM1 Rabbit Polyclonal Antibody
TA330023 100 µL

PRDM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Luria-Bertani (LB) Lennox Agar Plates w/ Amp-100 & IPTG (0.3mM)
30629311-5 80 Plates

Luria-Bertani (LB) Lennox Agar Plates w/ Amp-100 & IPTG (0.3mM)

Sign In for Pricing
View Details
FAUP1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0759904 1.0 µg DNA

FAUP1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PLXDC2 Antibody
KC-3376-01 50 μL

PLXDC2 Antibody

Sign In for Pricing
View Details
PLXDC2 Antibody
KC-3376-02 100 µL

PLXDC2 Antibody

Sign In for Pricing
View Details