Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAFFR/TNFRSF13C, Human (HEK293, hFc-Flag)

BAFFR/TNFRSF13C Protein, a B-cell receptor, specifically recognizes TNFSF13B/TALL1/BAFF/BLyS, playing a crucial role in promoting the survival of mature B-cells and enhancing the B-cell response, contributing to a healthy immune system. BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived BAFFR/TNFRSF13C protein, expressed by HEK293 , with C-hFc, C-Flag labeled tag.

Product Specifications

Product Name Alternative

BAFFR/TNFRSF13C Protein, Human (HEK293, hFc-Flag), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/baffr-tnfrsf13c-protein-human-hek293-hfc-flag.html

Smiles

SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA

Molecular Formula

115650 (Gene_ID) Q96RJ3-1 (S7-A71) (Accession)

Molecular Weight

36.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
BNC940633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details