Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3B, Human (His, Myc)

FAM3B Protein acts as a potent inducer of apoptosis, influencing alpha and beta cells in a dose- and time-dependent manner. Its regulatory impact on programmed cell death underscores its significance, particularly within apoptosis. The specificity for alpha and beta cells suggests targeted modulation of pancreatic cell populations, implicating FAM3B in key processes related to pancreatic function and homeostasis. FAM3B Protein, Human (His) is the recombinant human-derived FAM3B protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Product Specifications

Product Name Alternative

FAM3B Protein, Human (His, Myc), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fam3b-protein-human-206a-a-his.html

Smiles

ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS

Molecular Formula

54097 (Gene_ID) P58499-1 (E30-S235) (Accession)

Molecular Weight

30.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD168 Polyclonal Antibody, Cy5.5 Conjugated
bs-4736R-Cy5.5 100 µL

CD168 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Anti-PDCD4 Rabbit mAb
CMA5707-01 30 µL

Recombinant Anti-PDCD4 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-PDCD4 Rabbit mAb
CMA5707-02 50 μL

Recombinant Anti-PDCD4 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-PDCD4 Rabbit mAb
CMA5707-03 100 µL

Recombinant Anti-PDCD4 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-PDCD4 Rabbit mAb
CMA5707-04 200 µL

Recombinant Anti-PDCD4 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Monoclonal ACTH Antibody (CLIP/7197R) [Alexa Fluor 532]
NBP3-24042AF532 0.1 mL

Rabbit Monoclonal ACTH Antibody (CLIP/7197R) [Alexa Fluor 532]

Sign In for Pricing
View Details