Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein lin-28 homolog A (LIN28A), partial

Product Specifications

Product Name Alternative

Zinc finger CCHC domain-containing protein 1

Abbreviation

Recombinant Human LIN28A protein, partial

Gene Name

LIN28A

UniProt

Q9H9Z2

Expression Region

113-209aa

Organism

Homo sapiens (Human)

Target Sequence

GGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heart- and neural crest derivatives-expressed protein 2 (HAND2) Rat ELISA Kit
D9437 96 Tests

Heart- and neural crest derivatives-expressed protein 2 (HAND2) Rat ELISA Kit

Sign In for Pricing
View Details
Lentiviral human MYL6 shRNA (UAS) - Lentiviral human MYL6 shRNA (UAS, GFP) (100)
GTR15313500 1 Vial

Lentiviral human MYL6 shRNA (UAS) - Lentiviral human MYL6 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
FNDC5 Human qPCR Template Standard (NM_153756)
HK212016 1 Kit

FNDC5 Human qPCR Template Standard (NM_153756)

Sign In for Pricing
View Details
Lentiviral human UBE2K shRNA (UAS) - Lentiviral human UBE2K shRNA (UAS, RFP) (25)
GTR15140015 1 Vial

Lentiviral human UBE2K shRNA (UAS) - Lentiviral human UBE2K shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Recombinant Mycoplasma pulmonis Dihydrofolate reductase (folA)
MBS1367676-01 0.02 mg (E-Coli)

Recombinant Mycoplasma pulmonis Dihydrofolate reductase (folA)

Sign In for Pricing
View Details
Recombinant Mycoplasma pulmonis Dihydrofolate reductase (folA)
MBS1367676-02 0.1 mg (E-Coli)

Recombinant Mycoplasma pulmonis Dihydrofolate reductase (folA)

Sign In for Pricing
View Details