Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human YjeF N-terminal domain-containing protein 3 (YJEFN3)

Product Specifications

Product Name Alternative

YjeF_N3 (hYjeF_N3)

Abbreviation

Recombinant Human YJEFN3 protein

Gene Name

YJEFN3

UniProt

A6XGL0

Expression Region

1-299aa

Organism

Homo sapiens (Human)

Target Sequence

MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL

Tag

Tag-Free

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

May play a role in spermiogenesis and oogenesis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.2 kDa

References & Citations

"ApoA-I-binding protein (AI-BP) and its homologues hYjeF_N2 and hYjeF_N3 comprise the YjeF_N domain protein family in humans with a role in spermiogenesis and oogenesis." Rudolph C., Sigruener A., Hartmann A., Orso E., Bals-Pratsch M., Gronwald W., Seifert B., Kalbitzer H.R., Verdorfer I., Luetjens C.M., Ortmann O., Bornstein S.R., Schmitz G. Horm. Metab. Res. 39:322-335 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF405S conjugate, 0.1mg/mL
BNC041999-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCNA (PCNA/694), CF594 conjugate, 0.1mg/mL
BNC940694-100 1x 100 µL

PCNA (PCNA/694), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCF4 (Transcription Factor 4) (TCF4/1705), CF640R conjugate, 0.1mg/mL
BNC401705-500 1x 500 µL

TCF4 (Transcription Factor 4) (TCF4/1705), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/765), CF568 conjugate, 0.1mg/mL
BNC680765-500 1x 500 µL

Chromogranin A (CHGA/765), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details