Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP11, Human (HEK293, Fc)

The FKBP11 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that plays a crucial role in accelerating protein folding, especially in complex protein synthesis. FKBP11 uses its enzymatic abilities to promote rapid and precise conformational changes that are critical for correct protein folding and maturation. FKBP11 Protein, Human (HEK293, Fc) is the recombinant human-derived FKBP11 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

FKBP11 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fkbp11-protein-human-hek293-fc.html

Purity

98.0

Smiles

GLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKG

Molecular Formula

51303 (Gene_ID) Q9NYL4 (G28-G155) (Accession)

Molecular Weight

Approximately 40.4-45 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cathepsin B (CTSB/CPSB/Catherpsin B1) ELISA Kit, 96 tests, quantitative
100-640-CBH 1 Kit

Human Cathepsin B (CTSB/CPSB/Catherpsin B1) ELISA Kit, 96 tests, quantitative

Sign In for Pricing
View Details
Mbd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6383906 1.0 µg DNA

Mbd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
2- (P-tolyloxy) pyrimidine-5-carboxylic acid
OR1086602-01 250 mg

2- (P-tolyloxy) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details
2- (P-tolyloxy) pyrimidine-5-carboxylic acid
OR1086602-02 500 mg

2- (P-tolyloxy) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details
2- (P-tolyloxy) pyrimidine-5-carboxylic acid
OR1086602-03 1 g

2- (P-tolyloxy) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details
2- (P-tolyloxy) pyrimidine-5-carboxylic acid
OR1086602-04 5 g

2- (P-tolyloxy) pyrimidine-5-carboxylic acid

Sign In for Pricing
View Details