Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Carbonic Anhydrase 5B, Human (His)

Carbonic Anhydrase 5B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase V (CA-V) is a mitochondrial enzyme that provides bicarbonate for pyruvate carboxylase in liver and kidney[1].

Product Specifications

Product Name Alternative

Carbonic Anhydrase 5B Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/carbonic-anhydrase-5b-protein-human-his.html

Purity

95.00

Smiles

CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATPHHHHHH

Molecular Formula

11238 (Gene_ID) Q9Y2D0 (C34-P317) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]A K Parkkila, et al. Expression of carbonic anhydrase V in pancreatic beta cells suggests role for mitochondrial carbonic anhydrase in insulin secretion. J Biol Chem. 1998 Sep 18;273 (38) :24620-3.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (PE)
MBS6129675-01 0.1 mL

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (PE)

Ask
View Details
Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (PE)
MBS6129675-02 5x 0.1 mL

Troponin I, Cardiac (cTnI, CMH7, Familial Hypertrophic Cardiomyopathy 7, MGC116817, TNNC1, Troponin I Type 3 Cardiac, TNNI3) (PE)

Ask
View Details
MRPL19 (NM_014763) Human Recombinant Protein
TP304329M 100 µg

MRPL19 (NM_014763) Human Recombinant Protein

Ask
View Details
Exportin 5 Antibody
E51A06144 100 µL

Exportin 5 Antibody

Ask
View Details
PR Double Nickase Plasmid (h2)
sc-400198-NIC-2 20 µg

PR Double Nickase Plasmid (h2)

Ask
View Details
Lentiviral mouse Npy shRNA (UAS) - Lentiviral mouse Npy shRNA (UAS) (100)
GTR15185550 1 Vial

Lentiviral mouse Npy shRNA (UAS) - Lentiviral mouse Npy shRNA (UAS) (100)

Ask
View Details