PEA15, Human
The PEA15 protein is a regulator of multiple cellular processes that blocks Ras-mediated integrin inhibition and modulates the ERK MAP kinase cascade. It inhibits RPS6KA3 activity by sequestering RPS6KA3 in the cytoplasm, regulating key cellular pathways. PEA15 Protein, Human is the recombinant human-derived PEA15 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
PEA15 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pea15-protein-human.html
Smiles
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Molecular Formula
8682 (Gene_ID) Q15121 (M1-A130) (Accession)
Molecular Weight
Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![Thrombomodulin (THBD) Mouse Monoclonal Antibody [Clone ID: B-A35]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fcfd6/imageurl/am31356fc-n.webp)
Thrombomodulin (THBD) Mouse Monoclonal Antibody [Clone ID: B-A35]
