Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-24, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-24 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-24-protein-human-hek293-his.html

Purity

98.40

Smiles

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Formula

11009 (Gene_ID) Q13007-2/NP_001172085.1 (Q53-L207) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT16 Polyclonal Antibody
CAC15693-01 50 µg

KRT16 Polyclonal Antibody

Sign In for Pricing
View Details
KRT16 Polyclonal Antibody
CAC15693-02 100 µg

KRT16 Polyclonal Antibody

Sign In for Pricing
View Details
Human Choline/ethanolamine kinase (CHKB) ELISA Kit
RK10557 96 Tests

Human Choline/ethanolamine kinase (CHKB) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Med26 shRNA (UAS) - Lentiviral mouse Med26 shRNA (UAS) plasmid
GTR15127219 1 Vial

Lentiviral mouse Med26 shRNA (UAS) - Lentiviral mouse Med26 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CLDN23, CT (CLDN23, Claudin-23) (AP) discontinued
033965-AP 200 µL

CLDN23, CT (CLDN23, Claudin-23) (AP) discontinued

Sign In for Pricing
View Details
Spag4 Rat shRNA Lentiviral Particle (Locus ID 83623)
TL711583V 500 µL Each

Spag4 Rat shRNA Lentiviral Particle (Locus ID 83623)

Sign In for Pricing
View Details