Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-24, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-24 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-24-protein-human-hek293-his.html

Purity

98.40

Smiles

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Formula

11009 (Gene_ID) Q13007-2/NP_001172085.1 (Q53-L207) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GAD65 IgG1 antibody (GAD65-IgG1 Ab) ELISA Kit
YP-W23477-01 48 Tests

Mouse GAD65 IgG1 antibody (GAD65-IgG1 Ab) ELISA Kit

Sign In for Pricing
View Details
Mouse GAD65 IgG1 antibody (GAD65-IgG1 Ab) ELISA Kit
YP-W23477-02 96 Tests

Mouse GAD65 IgG1 antibody (GAD65-IgG1 Ab) ELISA Kit

Sign In for Pricing
View Details
HADHB Peptide
MBS3233831-01 0.1 mg

HADHB Peptide

Sign In for Pricing
View Details
HADHB Peptide
MBS3233831-02 5x 0.1 mg

HADHB Peptide

Sign In for Pricing
View Details
4930486L24Rik (NM_178098) Mouse Tagged ORF Clone Lentiviral Particle
MR204922L3V 200 µL

4930486L24Rik (NM_178098) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
01/09/2006 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2802508 1.0 µg DNA

01/09/2006 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details