Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-24, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-24 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-24-protein-human-hek293-his.html

Purity

98.40

Smiles

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Formula

11009 (Gene_ID) Q13007-2/NP_001172085.1 (Q53-L207) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRSN1 3'UTR Luciferase Stable Cell Line
TU015984 1.0 mL

NRSN1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
[β-Ala70]-C3a (70-77)
E-PP-0017-01 10 mg

[β-Ala70]-C3a (70-77)

Sign In for Pricing
View Details
[β-Ala70]-C3a (70-77)
E-PP-0017-02 100 mg

[β-Ala70]-C3a (70-77)

Sign In for Pricing
View Details
[β-Ala70]-C3a (70-77)
E-PP-0017-03 5 mg

[β-Ala70]-C3a (70-77)

Sign In for Pricing
View Details
KRTAP1-3, ID (KRTAP1-3, B2B, KAP1.2, KAP1.3, KAP1.8, KAP1.9, KRATP1.9, KRTAP1.8, Keratin-associated protein 1-3, Keratin-associated protein 1.8, Keratin-associated protein 1.9) (APC) discontinued
037639-APC 200 µL

KRTAP1-3, ID (KRTAP1-3, B2B, KAP1.2, KAP1.3, KAP1.8, KAP1.9, KRATP1.9, KRTAP1.8, Keratin-associated protein 1-3, Keratin-associated protein 1.8, Keratin-associated protein 1.9) (APC) discontinued

Sign In for Pricing
View Details
Mouse Steep1 qPCR Primer Pair
QM45714S 200 Tests

Mouse Steep1 qPCR Primer Pair

Sign In for Pricing
View Details