Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-24, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-24 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-24-protein-human-hek293-his.html

Purity

98.40

Smiles

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Formula

11009 (Gene_ID) Q13007-2/NP_001172085.1 (Q53-L207) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tcf19 qPCR Primer Pair
QM50070S 200 Tests

Mouse Tcf19 qPCR Primer Pair

Sign In for Pricing
View Details
Human MAOA (Monoamine Oxidase A) ELISA Kit
EK244989 96 Well

Human MAOA (Monoamine Oxidase A) ELISA Kit

Sign In for Pricing
View Details
4- (Trifluoromethoxy) phenacyl bromide
232699-01 1 g

4- (Trifluoromethoxy) phenacyl bromide

Sign In for Pricing
View Details
4- (Trifluoromethoxy) phenacyl bromide
232699-02 5 g

4- (Trifluoromethoxy) phenacyl bromide

Sign In for Pricing
View Details
4- (Trifluoromethoxy) phenacyl bromide
232699-03 25 g

4- (Trifluoromethoxy) phenacyl bromide

Sign In for Pricing
View Details
4- (Trifluoromethoxy) phenacyl bromide
232699-04 100 g

4- (Trifluoromethoxy) phenacyl bromide

Sign In for Pricing
View Details