Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-24, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-24 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-24-protein-human-hek293-his.html

Purity

98.40

Smiles

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Formula

11009 (Gene_ID) Q13007-2/NP_001172085.1 (Q53-L207) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nitrate Reductase Microplate Assay Kit
MBS4504372-01 100 Assays

Nitrate Reductase Microplate Assay Kit

Sign In for Pricing
View Details
Nitrate Reductase Microplate Assay Kit
MBS4504372-02 5x 100 Assays

Nitrate Reductase Microplate Assay Kit

Sign In for Pricing
View Details
Nitrate Reductase Microplate Assay Kit
MBS4504372-03 10x 100 Assays

Nitrate Reductase Microplate Assay Kit

Sign In for Pricing
View Details
Ubiquitin polyclonal antibody
ADI-SPA-200-D 50 µg

Ubiquitin polyclonal antibody

Sign In for Pricing
View Details
SLC30A1 Antibody
MBS9507115-01 0.05 mL

SLC30A1 Antibody

Sign In for Pricing
View Details
SLC30A1 Antibody
MBS9507115-02 0.1 mL

SLC30A1 Antibody

Sign In for Pricing
View Details