Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-24, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-24 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-24-protein-human-hek293-his.html

Purity

98.40

Smiles

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Formula

11009 (Gene_ID) Q13007-2/NP_001172085.1 (Q53-L207) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen alpha 1(XXVIII) chain (COL28A1) Human shRNA Lentiviral Particle (Locus ID 340267)
TL313798V 500 µL Each

Collagen alpha 1(XXVIII) chain (COL28A1) Human shRNA Lentiviral Particle (Locus ID 340267)

Sign In for Pricing
View Details
pExpress-1-Wasf1 Plasmid
PVT38426 2 µg

pExpress-1-Wasf1 Plasmid

Sign In for Pricing
View Details
Anti-CEA16 antibody
STJ190662 200 µl

Anti-CEA16 antibody

Sign In for Pricing
View Details
Mouse Slc2a6 Pre-designed siRNA Set A
SI113151A 1 Each

Mouse Slc2a6 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse Prb1 shRNA (UAS) - Lentiviral mouse Prb1 shRNA (UAS, GFP) plasmid
GTR15195214 1 Vial

Lentiviral mouse Prb1 shRNA (UAS) - Lentiviral mouse Prb1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RPL17P14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1913708 1.0 µg DNA

RPL17P14 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details