Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-24, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-24 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-24-protein-human-hek293-his.html

Purity

98.40

Smiles

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Formula

11009 (Gene_ID) Q13007-2/NP_001172085.1 (Q53-L207) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD200 Receptor 1 (Cd200r1, Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, Mox2r, OX102 Antigen, Ox2r) (HRP)
MBS6250477-01 0.1 mL

CD200 Receptor 1 (Cd200r1, Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, Mox2r, OX102 Antigen, Ox2r) (HRP)

Sign In for Pricing
View Details
CD200 Receptor 1 (Cd200r1, Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, Mox2r, OX102 Antigen, Ox2r) (HRP)
MBS6250477-02 5x 0.1 mL

CD200 Receptor 1 (Cd200r1, Cell Surface Glycoprotein CD200 Receptor 1, CD200 Cell Surface Glycoprotein Receptor, Cell Surface Glycoprotein OX2 Receptor 1, Mox2r, OX102 Antigen, Ox2r) (HRP)

Sign In for Pricing
View Details
Phospho-HSF1 (S307) Antibody
A22855-100UG 100 µg

Phospho-HSF1 (S307) Antibody

Sign In for Pricing
View Details
Recombinant Human DNA repair protein XRCC3 Protein, His-SUMO, E.coli-50ug
QP6893-ec-50ug 50ug

Recombinant Human DNA repair protein XRCC3 Protein, His-SUMO, E.coli-50ug

Sign In for Pricing
View Details
PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator, DYT16, HSD14, PACT, RAX) (MaxLight 650)
250499-ML650 100 µL

PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator, DYT16, HSD14, PACT, RAX) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal EWSR1 Antibody [DyLight 594]
NB200-182DL594 0.1 mL

Rabbit Polyclonal EWSR1 Antibody [DyLight 594]

Sign In for Pricing
View Details