Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-24, Human (HEK293, His)

Interleukin-24 (IL-24) belongs to the IL10 family of cytokines that selectively induces apoptosis in cancer cells and is recognized during melanoma cell differentiation. IL-24 overexpression increases the expression of GADD family genes and induces cell apoptosis. IL-24 Protein, Human (HEK293, His) is the recombinant human-derived IL-24 protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

IL-24 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-24-protein-human-hek293-his.html

Purity

98.40

Smiles

QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Molecular Formula

11009 (Gene_ID) Q13007-2/NP_001172085.1 (Q53-L207) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMX1B Antibody
A23808-100UG 100 µg

LMX1B Antibody

Sign In for Pricing
View Details
SPATA19 (NM_001291992) Human Untagged Clone
SC334109 10 µg

SPATA19 (NM_001291992) Human Untagged Clone

Sign In for Pricing
View Details
Magic™ Anti-Sturgeon IgM monoclonal antibody
CABT-B1049 200 µg

Magic™ Anti-Sturgeon IgM monoclonal antibody

Sign In for Pricing
View Details
Recombinant CD32A/CD32B/CD32C Antibody
RC-16556-01 50 μL

Recombinant CD32A/CD32B/CD32C Antibody

Sign In for Pricing
View Details
Recombinant CD32A/CD32B/CD32C Antibody
RC-16556-02 100 µL

Recombinant CD32A/CD32B/CD32C Antibody

Sign In for Pricing
View Details
Recombinant CD32A/CD32B/CD32C Antibody
RC-16556-03 1 mL

Recombinant CD32A/CD32B/CD32C Antibody

Sign In for Pricing
View Details