Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP7, Human (HEK293, His)

The FKBP7 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that significantly accelerates protein folding, especially in the complexities of protein synthesis. Utilizing its enzymatic abilities, FKBP7 plays a crucial role in coordinating timely conformational changes to achieve correct protein folding and maturation. FKBP7 Protein, Human (HEK293, His) is the recombinant human-derived FKBP7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FKBP7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fkbp7-protein-human-hek-293-his.html

Smiles

QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL

Molecular Formula

51661 (Gene_ID) Q9Y680-2 (Q24-L222) (Accession)

Molecular Weight

Approximately 25-32 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog