Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX4 Rabbit Polyclonal Antibody (HRP)

CBX4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PC2, NBP16

UniProt

O00257

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003646

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Il1rn Pre-designed siRNA Set B
SI106635B 1 Each

Mouse Il1rn Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Human E2F7 Polyclonal Antibody
PHN30001 100 μg

Anti-Human E2F7 Polyclonal Antibody

Sign In for Pricing
View Details
IL27R Rabbit Polyclonal Antibody (BF594)
orb2435333 100 µL

IL27R Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Human Putative biorientation of chromosomes in cell division protein 1-like 2, FAM44C ELISA Kit
MBS9325921-01 48 Well

Human Putative biorientation of chromosomes in cell division protein 1-like 2, FAM44C ELISA Kit

Sign In for Pricing
View Details
Human Putative biorientation of chromosomes in cell division protein 1-like 2, FAM44C ELISA Kit
MBS9325921-02 96 Well

Human Putative biorientation of chromosomes in cell division protein 1-like 2, FAM44C ELISA Kit

Sign In for Pricing
View Details
Human Putative biorientation of chromosomes in cell division protein 1-like 2, FAM44C ELISA Kit
MBS9325921-03 5x 96 Well

Human Putative biorientation of chromosomes in cell division protein 1-like 2, FAM44C ELISA Kit

Sign In for Pricing
View Details